BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021213 (707 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC20G8.06 |||CCR4-Not complex subunit Not1 |Schizosaccharomyce... 27 2.6 SPCC1919.04 |||sequence orphan|Schizosaccharomyces pombe|chr 3||... 25 8.0 >SPAC20G8.06 |||CCR4-Not complex subunit Not1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 2100 Score = 27.1 bits (57), Expect = 2.6 Identities = 16/43 (37%), Positives = 20/43 (46%) Frame = +1 Query: 109 GDRGYPGRPGLQGEQGMKGNKGQAAELVYGAKGEPGPRGLPGN 237 G+ Y G++ EQG A EL+ A G P LPGN Sbjct: 1491 GEVDYHVARGVRSEQGSGPVTDFAIELLRTAVGGENPMALPGN 1533 >SPCC1919.04 |||sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 256 Score = 25.4 bits (53), Expect = 8.0 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = -3 Query: 213 WFSFCAVHEFCRLAFITFHPLFTL*AWSSWIATI 112 W+ A F + IT +PL+ L +W+ ++ I Sbjct: 92 WYFIRAPARFILMVGITLYPLYVLLSWAVFLGII 125 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,692,741 Number of Sequences: 5004 Number of extensions: 55873 Number of successful extensions: 165 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 158 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 165 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 329179816 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -