BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021211 (780 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ182015-1|ABA56307.1| 353|Anopheles gambiae G(alpha)q2 protein. 38 3e-04 AY724808-1|AAW50317.1| 206|Anopheles gambiae G protein alpha su... 38 5e-04 DQ182016-1|ABA56308.1| 353|Anopheles gambiae G(alpha)i protein. 37 6e-04 DQ182017-1|ABA56309.1| 383|Anopheles gambiae G(alpha)s protein. 36 0.001 AY724807-1|AAW50316.1| 127|Anopheles gambiae G protein alpha su... 32 0.023 AY724806-1|AAW50315.1| 163|Anopheles gambiae G protein alpha su... 32 0.023 AY724804-1|AAW50313.1| 163|Anopheles gambiae G protein alpha su... 32 0.023 AY724805-1|AAW50314.1| 162|Anopheles gambiae G protein alpha su... 31 0.053 AY724803-1|AAW50312.1| 162|Anopheles gambiae G protein alpha su... 31 0.053 U29486-1|AAC46995.1| 695|Anopheles gambiae ATP-binding-cassette... 26 1.1 U29485-1|AAC46994.1| 695|Anopheles gambiae ATP-binding-cassette... 26 1.1 U29484-1|AAC47423.1| 673|Anopheles gambiae ATP-binding-cassette... 26 1.1 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 26 1.5 AY724802-1|AAW50311.1| 134|Anopheles gambiae G protein alpha su... 26 1.5 AY724801-1|AAW50310.1| 134|Anopheles gambiae G protein alpha su... 26 1.5 AJ439353-5|CAD27927.1| 459|Anopheles gambiae putative G-protein... 25 3.5 U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 24 4.6 AJ973474-1|CAJ01521.1| 191|Anopheles gambiae hypothetical prote... 23 8.0 AJ697734-1|CAG26927.1| 191|Anopheles gambiae putative chemosens... 23 8.0 AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcript... 23 8.0 >DQ182015-1|ABA56307.1| 353|Anopheles gambiae G(alpha)q2 protein. Length = 353 Score = 37.9 bits (84), Expect = 3e-04 Identities = 20/55 (36%), Positives = 26/55 (47%) Frame = +2 Query: 254 EDDRLAQHVPTLHPTSEELSIGSMRFTTFDLGGHQQARRVWRDYFPAVDAIVFLV 418 E D L VPT + +RF D+GG + RR W F V +I+FLV Sbjct: 170 EQDILRVRVPTTGIIEYPFDLEEIRFRMVDVGGQRSERRKWIHCFENVTSIIFLV 224 Score = 23.8 bits (49), Expect = 6.1 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +3 Query: 198 KLLFLGLDNAGKTTLLHMLKMI 263 KLL LG +GK+T + +++I Sbjct: 35 KLLLLGTGESGKSTFIKQMRII 56 >AY724808-1|AAW50317.1| 206|Anopheles gambiae G protein alpha subunit AgGq6 protein. Length = 206 Score = 37.5 bits (83), Expect = 5e-04 Identities = 23/81 (28%), Positives = 38/81 (46%) Frame = +2 Query: 176 WSMEKVRQALVSGT*QCREDNTLTHVEDDRLAQHVPTLHPTSEELSIGSMRFTTFDLGGH 355 + +E++R + +S + ++ L E D L PT + S+ F D+GG Sbjct: 2 FDLEEIRFSYLSDLARIEAEDFLP-TEQDILRARAPTTGILEYPFDLDSIIFRMVDVGGQ 60 Query: 356 QQARRVWRDYFPAVDAIVFLV 418 + RR W F V +I+FLV Sbjct: 61 RSERRKWIHCFENVTSIIFLV 81 >DQ182016-1|ABA56308.1| 353|Anopheles gambiae G(alpha)i protein. Length = 353 Score = 37.1 bits (82), Expect = 6e-04 Identities = 19/55 (34%), Positives = 25/55 (45%) Frame = +2 Query: 254 EDDRLAQHVPTLHPTSEELSIGSMRFTTFDLGGHQQARRVWRDYFPAVDAIVFLV 418 + D L V T S S+ F FD+GG + R+ W F V AI+F V Sbjct: 170 QQDVLRTRVKTTGIVETHFSFKSIHFKMFDVGGQRSERKKWIHCFEGVTAIIFCV 224 Score = 25.4 bits (53), Expect = 2.0 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = +3 Query: 198 KLLFLGLDNAGKTTLLHMLKMI 263 KLL LG +GK+T++ +K+I Sbjct: 34 KLLLLGAGESGKSTIVKQMKII 55 >DQ182017-1|ABA56309.1| 383|Anopheles gambiae G(alpha)s protein. Length = 383 Score = 35.9 bits (79), Expect = 0.001 Identities = 22/61 (36%), Positives = 27/61 (44%) Frame = +2 Query: 245 THVEDDRLAQHVPTLHPTSEELSIGSMRFTTFDLGGHQQARRVWRDYFPAVDAIVFLVDA 424 T E D L V T + + F FD+GG + RR W F V AI+F V A Sbjct: 180 TPTEQDILRCRVLTSGIFETRFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIF-VTA 238 Query: 425 C 427 C Sbjct: 239 C 239 >AY724807-1|AAW50316.1| 127|Anopheles gambiae G protein alpha subunit AgGq5 protein. Length = 127 Score = 31.9 bits (69), Expect = 0.023 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +2 Query: 323 MRFTTFDLGGHQQARRVWRDYFPAVDAIVFLV 418 +RF D+GG + RR W F V +I+FLV Sbjct: 7 IRFRMVDVGGQRSERRKWIHCFENVTSIIFLV 38 >AY724806-1|AAW50315.1| 163|Anopheles gambiae G protein alpha subunit AgGq4 protein. Length = 163 Score = 31.9 bits (69), Expect = 0.023 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +2 Query: 323 MRFTTFDLGGHQQARRVWRDYFPAVDAIVFLV 418 +RF D+GG + RR W F V +I+FLV Sbjct: 7 IRFRMVDVGGQRSERRKWIHCFENVTSIIFLV 38 >AY724804-1|AAW50313.1| 163|Anopheles gambiae G protein alpha subunit AgGq2 protein. Length = 163 Score = 31.9 bits (69), Expect = 0.023 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +2 Query: 323 MRFTTFDLGGHQQARRVWRDYFPAVDAIVFLV 418 +RF D+GG + RR W F V +I+FLV Sbjct: 7 IRFRMVDVGGQRSERRKWIHCFENVTSIIFLV 38 >AY724805-1|AAW50314.1| 162|Anopheles gambiae G protein alpha subunit AgGq3 protein. Length = 162 Score = 30.7 bits (66), Expect = 0.053 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +2 Query: 314 IGSMRFTTFDLGGHQQARRVWRDYFPAVDAIVFLV 418 + S+ F D+GG + RR W F V +I+FLV Sbjct: 3 LDSIIFRMVDVGGQRSERRKWIHCFENVTSIIFLV 37 >AY724803-1|AAW50312.1| 162|Anopheles gambiae G protein alpha subunit AgGq1 protein. Length = 162 Score = 30.7 bits (66), Expect = 0.053 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +2 Query: 314 IGSMRFTTFDLGGHQQARRVWRDYFPAVDAIVFLV 418 + S+ F D+GG + RR W F V +I+FLV Sbjct: 3 LDSIIFRMVDVGGQRSERRKWIHCFENVTSIIFLV 37 >U29486-1|AAC46995.1| 695|Anopheles gambiae ATP-binding-cassette protein protein. Length = 695 Score = 26.2 bits (55), Expect = 1.1 Identities = 14/23 (60%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Frame = +3 Query: 189 KSGKLL-FLGLDNAGKTTLLHML 254 KSG+LL +G AGKTTLL+ L Sbjct: 124 KSGELLAVMGSSGAGKTTLLNAL 146 >U29485-1|AAC46994.1| 695|Anopheles gambiae ATP-binding-cassette protein protein. Length = 695 Score = 26.2 bits (55), Expect = 1.1 Identities = 14/23 (60%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Frame = +3 Query: 189 KSGKLL-FLGLDNAGKTTLLHML 254 KSG+LL +G AGKTTLL+ L Sbjct: 124 KSGELLAVMGSSGAGKTTLLNAL 146 >U29484-1|AAC47423.1| 673|Anopheles gambiae ATP-binding-cassette protein protein. Length = 673 Score = 26.2 bits (55), Expect = 1.1 Identities = 14/23 (60%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Frame = +3 Query: 189 KSGKLL-FLGLDNAGKTTLLHML 254 KSG+LL +G AGKTTLL+ L Sbjct: 102 KSGELLAVMGSSGAGKTTLLNAL 124 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/37 (32%), Positives = 20/37 (54%), Gaps = 6/37 (16%) Frame = +1 Query: 154 SLECWDFLVYGKSQASSCF------WDLTMQGRQHSY 246 S++CW F + G QA+ + W++TM+ R Y Sbjct: 503 SVDCWSFEIDGFKQATIKYYPSKERWEMTMEDRTFVY 539 >AY724802-1|AAW50311.1| 134|Anopheles gambiae G protein alpha subunit AgOn protein. Length = 134 Score = 25.8 bits (54), Expect = 1.5 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +3 Query: 189 KSGKLLFLGLDNAGKTTLLHMLKMI 263 K KLL LG +GK+T++ +K+I Sbjct: 19 KDIKLLLLGAGESGKSTIVKQMKII 43 >AY724801-1|AAW50310.1| 134|Anopheles gambiae G protein alpha subunit AgOa protein. Length = 134 Score = 25.8 bits (54), Expect = 1.5 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +3 Query: 189 KSGKLLFLGLDNAGKTTLLHMLKMI 263 K KLL LG +GK+T++ +K+I Sbjct: 19 KDIKLLLLGAGESGKSTIVKQMKII 43 >AJ439353-5|CAD27927.1| 459|Anopheles gambiae putative G-protein coupled receptor protein. Length = 459 Score = 24.6 bits (51), Expect = 3.5 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = -3 Query: 283 RYMLSKSIIFNMCKSVVFPALSSPRNKSLP 194 RYM S++ FNM + + P S + LP Sbjct: 430 RYMFSRNQRFNMVDAALSPMQKSTNSSPLP 459 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 24.2 bits (50), Expect = 4.6 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = -2 Query: 422 RRPGTLWRPPRGSSRATHDAPADAHRGRTS*N 327 R P + WR +++TH + ++G TS N Sbjct: 465 RWPDSFWRFYNSKTKSTHTPKSITYKGATSAN 496 >AJ973474-1|CAJ01521.1| 191|Anopheles gambiae hypothetical protein protein. Length = 191 Score = 23.4 bits (48), Expect = 8.0 Identities = 12/49 (24%), Positives = 23/49 (46%) Frame = -1 Query: 354 CPPRSNVVKRILPIDSSSDVGCKVGTC*ASLSSSTCVRVLSSLHCQVPE 208 CPP +KRILP + K C + + +++++ L+ P+ Sbjct: 60 CPPEGKDLKRILP----EALRTKCARC-SPIQKENALKIITRLYYDYPD 103 >AJ697734-1|CAG26927.1| 191|Anopheles gambiae putative chemosensory protein CSP5 protein. Length = 191 Score = 23.4 bits (48), Expect = 8.0 Identities = 12/49 (24%), Positives = 23/49 (46%) Frame = -1 Query: 354 CPPRSNVVKRILPIDSSSDVGCKVGTC*ASLSSSTCVRVLSSLHCQVPE 208 CPP +KRILP + K C + + +++++ L+ P+ Sbjct: 60 CPPEGKDLKRILP----EALRTKCARC-SPIQKENALKIITRLYYDYPD 103 >AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcriptase protein. Length = 1222 Score = 23.4 bits (48), Expect = 8.0 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -2 Query: 419 RPGTLWRPPRGSSRATHDAPADA 351 R GTL P G +R + AP++A Sbjct: 1152 REGTLPTVPHGRNRRSRSAPSEA 1174 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 757,779 Number of Sequences: 2352 Number of extensions: 16212 Number of successful extensions: 65 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 61 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 65 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 81497388 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -