BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021207 (537 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY334011-1|AAR01136.1| 188|Anopheles gambiae beta-tubulin protein. 94 3e-21 AY334010-1|AAR01135.1| 188|Anopheles gambiae beta-tubulin protein. 94 3e-21 AY334009-1|AAR01134.1| 188|Anopheles gambiae beta-tubulin protein. 94 3e-21 AY334008-1|AAR01133.1| 188|Anopheles gambiae beta-tubulin protein. 94 3e-21 U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles ... 27 0.53 AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign... 26 0.70 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 25 1.6 AJ441131-2|CAD29631.1| 208|Anopheles gambiae hypothetical prote... 23 4.9 AF117749-1|AAD38335.1| 372|Anopheles gambiae serine protease 14... 23 4.9 AY873992-1|AAW71999.1| 259|Anopheles gambiae nanos protein. 23 6.5 AY583530-1|AAS93544.1| 260|Anopheles gambiae NOS protein protein. 23 6.5 AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P... 23 6.5 AJ439398-1|CAD28124.1| 208|Anopheles gambiae hypothetical prote... 23 6.5 DQ437579-1|ABD96049.1| 575|Anopheles gambiae short neuropeptide... 23 8.6 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 23 8.6 AJ297931-1|CAC35451.1| 166|Anopheles gambiae hypothetical prote... 23 8.6 >AY334011-1|AAR01136.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 93.9 bits (223), Expect = 3e-21 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = +1 Query: 400 HYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGVGTGSGMGTL 537 HYTEGAELVD+VLDVVRKE E+CDCLQGFQLTHSLG GTGSGMGTL Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTL 46 >AY334010-1|AAR01135.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 93.9 bits (223), Expect = 3e-21 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = +1 Query: 400 HYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGVGTGSGMGTL 537 HYTEGAELVD+VLDVVRKE E+CDCLQGFQLTHSLG GTGSGMGTL Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTL 46 >AY334009-1|AAR01134.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 93.9 bits (223), Expect = 3e-21 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = +1 Query: 400 HYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGVGTGSGMGTL 537 HYTEGAELVD+VLDVVRKE E+CDCLQGFQLTHSLG GTGSGMGTL Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTL 46 >AY334008-1|AAR01133.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 93.9 bits (223), Expect = 3e-21 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = +1 Query: 400 HYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGVGTGSGMGTL 537 HYTEGAELVD+VLDVVRKE E+CDCLQGFQLTHSLG GTGSGMGTL Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTL 46 >U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles gambiae putativetubulin alpha chain mRNA, complete cds. ). Length = 91 Score = 26.6 bits (56), Expect = 0.53 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +2 Query: 89 MREIVHIQAGQCGNQIGAKFWE 154 MRE + + GQ G QIG W+ Sbjct: 1 MRECISVHVGQAGVQIGNPCWD 22 >AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-signaling promoter protein. Length = 1197 Score = 26.2 bits (55), Expect = 0.70 Identities = 22/68 (32%), Positives = 28/68 (41%), Gaps = 12/68 (17%) Frame = -2 Query: 356 KLSGRKICPKGPERTESMVPGS-----------KSTRMARGTYLPRRLHCSIH*CAPT-A 213 +LS K PKG E MVP S + R+ GT + CS C+ T + Sbjct: 1036 RLSHSKSWPKGTENENYMVPPSPRPVSEELHLVRGVRLGSGTLVGALNRCSNGSCSSTSS 1095 Query: 212 SQSPHGKH 189 S S H H Sbjct: 1096 SHSNHSSH 1103 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 25.0 bits (52), Expect = 1.6 Identities = 11/44 (25%), Positives = 24/44 (54%) Frame = -2 Query: 536 RVPIPEPVPTPSECVSWNPWRQSHDSASFRTTSKTESTSSAPSV 405 R+P P +P P+E + + + S+ +T +T++ ++ SV Sbjct: 105 RLPCPNLIPRPAEVPTTPEHKSAASSSCSLSTLETQTATAGASV 148 >AJ441131-2|CAD29631.1| 208|Anopheles gambiae hypothetical protein protein. Length = 208 Score = 23.4 bits (48), Expect = 4.9 Identities = 16/57 (28%), Positives = 25/57 (43%), Gaps = 4/57 (7%) Frame = +1 Query: 265 VPRAILVDLEPGTMDSVRSGPFGQIF----RPDNFVFGQSGAGNNWAKGHYTEGAEL 423 +P + L G+ +S FG F RP N+ + ++ NN + H T A L Sbjct: 106 LPSLAITGLSIGSSNSSFLRQFGPQFTGTKRPQNWFYSRNNNNNNNNEHHNTYNARL 162 >AF117749-1|AAD38335.1| 372|Anopheles gambiae serine protease 14D2 protein. Length = 372 Score = 23.4 bits (48), Expect = 4.9 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +1 Query: 361 FGQSGAGNNWAKGHYTEGAELVDSVLDVV 447 FG G + G YT +E +D VLD + Sbjct: 343 FGLEQCGTDGVPGVYTRMSEYMDWVLDTM 371 >AY873992-1|AAW71999.1| 259|Anopheles gambiae nanos protein. Length = 259 Score = 23.0 bits (47), Expect = 6.5 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = -2 Query: 437 KTESTSSAPSV*CPLAQLLPAPDCPKTKLSGRKICPKG 324 K T + + CPL ++ DC +L KI KG Sbjct: 195 KATGTKAHTAKYCPLKPVITPEDCLAMELRRHKIHRKG 232 >AY583530-1|AAS93544.1| 260|Anopheles gambiae NOS protein protein. Length = 260 Score = 23.0 bits (47), Expect = 6.5 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = -2 Query: 437 KTESTSSAPSV*CPLAQLLPAPDCPKTKLSGRKICPKG 324 K T + + CPL ++ DC +L KI KG Sbjct: 196 KATGTKAHTAKYCPLKPVITPEDCLAMELRRHKIHRKG 233 >AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P450 reductase protein. Length = 679 Score = 23.0 bits (47), Expect = 6.5 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +2 Query: 143 KFWEIISDEHGIDPTG 190 KFW + D GI+ TG Sbjct: 225 KFWPTVCDYFGIESTG 240 >AJ439398-1|CAD28124.1| 208|Anopheles gambiae hypothetical protein protein. Length = 208 Score = 23.0 bits (47), Expect = 6.5 Identities = 16/57 (28%), Positives = 25/57 (43%), Gaps = 4/57 (7%) Frame = +1 Query: 265 VPRAILVDLEPGTMDSVRSGPFGQIF----RPDNFVFGQSGAGNNWAKGHYTEGAEL 423 +P + L G+ +S FG F RP N+ + ++ NN + H T A L Sbjct: 106 LPSLAITGLSIGSSNSRFLRQFGPQFTGTNRPQNWFYSRNNNNNNNNEHHNTYNARL 162 >DQ437579-1|ABD96049.1| 575|Anopheles gambiae short neuropeptide F receptor protein. Length = 575 Score = 22.6 bits (46), Expect = 8.6 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = -3 Query: 280 GWRGARTCRG 251 GWR RTC G Sbjct: 417 GWRSERTCNG 426 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 22.6 bits (46), Expect = 8.6 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -3 Query: 190 TGGVDAVLVGDDLPELSSDLVAALTSLDMYD 98 TGG ++ L+G L++ LV +L L D Sbjct: 788 TGGTESQLIGAIFKTLATRLVQSLKELKSQD 818 >AJ297931-1|CAC35451.1| 166|Anopheles gambiae hypothetical protein protein. Length = 166 Score = 22.6 bits (46), Expect = 8.6 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -3 Query: 160 DDLPELSSDLVAALTSLDMYDFP 92 D +PE+ SDL L L + D P Sbjct: 21 DSVPEVPSDLQQQLDELQLADKP 43 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 587,012 Number of Sequences: 2352 Number of extensions: 12107 Number of successful extensions: 35 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 35 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 49897362 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -