BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021206 (733 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx mori|... 46 0.001 UniRef50_A6L6Q7 Cluster: Putative uncharacterized protein; n=1; ... 35 1.8 >UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx mori|Rep: NADPH oxidoreductase - Bombyx mori (Silk moth) Length = 191 Score = 45.6 bits (103), Expect = 0.001 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = -3 Query: 575 FLLPRWVDELTAHLVLSGYQSPK 507 FLL RWVDELTAHLVLSGY SP+ Sbjct: 154 FLLLRWVDELTAHLVLSGYWSPR 176 >UniRef50_A6L6Q7 Cluster: Putative uncharacterized protein; n=1; Bacteroides vulgatus ATCC 8482|Rep: Putative uncharacterized protein - Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) Length = 438 Score = 35.1 bits (77), Expect = 1.8 Identities = 22/69 (31%), Positives = 32/69 (46%) Frame = +1 Query: 409 VPHFKANDMMNTETLELISQGTHLFRRIYVVDVLGLW*PLNTRWAVSSSTHLGNKNKTTL 588 VP + D N E ELI+ G + Y+ D L + P+ TRW +S GN + Sbjct: 72 VPRPTSEDWGNAE--ELIASGEYSSMDAYLSDWLA-FNPMETRWFYVTSRKYGNNRSIHV 128 Query: 589 NDHRCGHFI 615 D + HF+ Sbjct: 129 TDRKFTHFV 137 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 579,094,778 Number of Sequences: 1657284 Number of extensions: 10504065 Number of successful extensions: 20969 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 20335 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20960 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 59265488880 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -