BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021203 (762 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 25 0.66 AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory recept... 23 3.5 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 22 4.6 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 22 4.6 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 8.1 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 25.0 bits (52), Expect = 0.66 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = +3 Query: 453 VLNDSIPGVIIRPFTTLINLMFSCSVQFFLVLICFQLF 566 VLN I + +R ++ ++ + + FFL LI F++F Sbjct: 272 VLNKHIDNISLRARKQVVLMLGTVVLSFFLCLIPFRVF 309 >AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory receptor candidate 43 protein. Length = 353 Score = 22.6 bits (46), Expect = 3.5 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +1 Query: 61 SYNVVIIYSLC 93 +Y VVIIYS+C Sbjct: 126 AYGVVIIYSIC 136 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 22.2 bits (45), Expect = 4.6 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = -3 Query: 625 FSTVISN*RSWLRKIKKRLENSWKQIS 545 F+ +I +W+R ++K L WK S Sbjct: 127 FAYLIPEVGTWIRAVRKCLYKLWKMPS 153 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 22.2 bits (45), Expect = 4.6 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = -3 Query: 625 FSTVISN*RSWLRKIKKRLENSWKQIS 545 F+ +I +W+R ++K L WK S Sbjct: 127 FAYLIPEVGTWIRAVRKCLYKLWKMPS 153 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.4 bits (43), Expect = 8.1 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +1 Query: 292 RRRRFVHAGITFTHGY 339 RRR F+ + ITF Y Sbjct: 273 RRREFIRSAITFIKQY 288 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,505 Number of Sequences: 336 Number of extensions: 3479 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20442493 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -