BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021203 (762 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-14|CAD27765.1| 471|Anopheles gambiae putative acetyltr... 27 0.48 AJ000675-1|CAA04232.1| 600|Anopheles gambiae infection responsi... 25 3.4 AY146733-1|AAO12093.1| 131|Anopheles gambiae odorant-binding pr... 24 5.9 AJ697724-1|CAG26917.1| 131|Anopheles gambiae putative odorant-b... 24 5.9 DQ974173-1|ABJ52813.1| 553|Anopheles gambiae serpin 16 protein. 23 7.8 AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi... 23 7.8 AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transc... 23 7.8 >AJ439060-14|CAD27765.1| 471|Anopheles gambiae putative acetyltransferase protein. Length = 471 Score = 27.5 bits (58), Expect = 0.48 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = -3 Query: 631 HSFSTVISN*RSWLRKIKKRLENSWKQISTKK 536 H F I+N W R +++ WK+I T++ Sbjct: 41 HYFVLPINNKDKWYRTCNRQINQQWKRIRTER 72 >AJ000675-1|CAA04232.1| 600|Anopheles gambiae infection responsive serine proteaselike protein protein. Length = 600 Score = 24.6 bits (51), Expect = 3.4 Identities = 14/34 (41%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = +2 Query: 374 CQVSIAYCCYVRSESASSRNYK--VMQMSSERFY 469 C + YCC RSE SRN + Q S R Y Sbjct: 59 CSDATHYCCPDRSEQLPSRNRPKLLTQCDSNRGY 92 >AY146733-1|AAO12093.1| 131|Anopheles gambiae odorant-binding protein AgamOBP23 protein. Length = 131 Score = 23.8 bits (49), Expect = 5.9 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +3 Query: 120 NVFKAESCFDTAFGCESLAMIYK*ELTSNVR 212 ++F E +T G ESL + +LT+N R Sbjct: 29 SIFALECMAETGIGAESLTKLRDGDLTANDR 59 >AJ697724-1|CAG26917.1| 131|Anopheles gambiae putative odorant-binding protein OBPjj14 protein. Length = 131 Score = 23.8 bits (49), Expect = 5.9 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +3 Query: 120 NVFKAESCFDTAFGCESLAMIYK*ELTSNVR 212 ++F E +T G ESL + +LT+N R Sbjct: 29 SIFALECMAETGIGAESLTKLRDGDLTANDR 59 >DQ974173-1|ABJ52813.1| 553|Anopheles gambiae serpin 16 protein. Length = 553 Score = 23.4 bits (48), Expect = 7.8 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -3 Query: 502 KVVNGLMITPGIESFRTHLHNL 437 K + L+ G E +R HLHN+ Sbjct: 119 KTKDELIQVLGFEQYRNHLHNI 140 >AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoisomerase protein. Length = 1039 Score = 23.4 bits (48), Expect = 7.8 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -3 Query: 673 LVVPHSSNTTPTCYHSFSTVIS 608 L +P SSN++P+ Y S VIS Sbjct: 866 LKMPPSSNSSPSSYPSPDVVIS 887 >AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transcription factor pannier protein. Length = 537 Score = 23.4 bits (48), Expect = 7.8 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +1 Query: 670 PAVRANSAGDYNGGQAGGNSALP 738 P +N G+ NGG GG S P Sbjct: 384 PTGGSNLPGNNNGGAGGGGSNTP 406 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 778,718 Number of Sequences: 2352 Number of extensions: 15056 Number of successful extensions: 32 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79002570 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -