BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021203 (762 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL110479-17|CAB54363.3| 177|Caenorhabditis elegans Hypothetical... 31 1.2 >AL110479-17|CAB54363.3| 177|Caenorhabditis elegans Hypothetical protein Y105C5B.18 protein. Length = 177 Score = 30.7 bits (66), Expect = 1.2 Identities = 19/60 (31%), Positives = 31/60 (51%), Gaps = 1/60 (1%) Frame = -3 Query: 550 ISTKKN*TEHENIKFIKVVNGLMITPGIESFRTHLHNLVV-PARGALRSDVAAISYTDLT 374 ++ K+N TE+E I ++NG+ I+ ++H LV PA +L IS D+T Sbjct: 19 VTVKRNMTEYEQKIHINLLNGIRQKNAIDEQVANMHELVYDPALESLSYPECEISNDDIT 78 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,059,547 Number of Sequences: 27780 Number of extensions: 338626 Number of successful extensions: 923 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 886 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 920 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1819579054 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -