BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021201 (677 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cogna... 94 1e-21 AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock prote... 94 1e-21 AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock prote... 84 9e-19 EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 23 2.3 DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 23 3.0 EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 22 4.0 AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 21 7.0 >AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cognate 70 protein. Length = 196 Score = 93.9 bits (223), Expect = 1e-21 Identities = 45/52 (86%), Positives = 48/52 (92%) Frame = +2 Query: 353 INEPTAAAIAYGLDKKGTGERNVLIFYLGGGTFDVSILTIEDGIFEVKSTAG 508 INEPTAAAIAYGLDKK ERNVLIF LGGGTFDVS+LTIE+GIFEVK+TAG Sbjct: 1 INEPTAAAIAYGLDKKAEKERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAG 52 Score = 43.6 bits (98), Expect = 2e-06 Identities = 19/46 (41%), Positives = 25/46 (54%) Frame = +1 Query: 511 THLGGEDFDNRMVNHFVQEFKRTYXXXXXXXXXXXXXXXXXCERAR 648 THLGGEDFDNR+V + Q+FK+ + CERA+ Sbjct: 54 THLGGEDFDNRLVEYCTQDFKKKHKADISGNPRALRRLRTQCERAK 99 Score = 22.6 bits (46), Expect = 3.0 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +3 Query: 645 KRTLSSSTQAS 677 KRTLSS+TQAS Sbjct: 99 KRTLSSATQAS 109 >AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock protein 70 protein. Length = 196 Score = 93.9 bits (223), Expect = 1e-21 Identities = 45/52 (86%), Positives = 48/52 (92%) Frame = +2 Query: 353 INEPTAAAIAYGLDKKGTGERNVLIFYLGGGTFDVSILTIEDGIFEVKSTAG 508 INEPTAAAIAYGLDKK ERNVLIF LGGGTFDVS+LTIE+GIFEVK+TAG Sbjct: 1 INEPTAAAIAYGLDKKAERERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAG 52 Score = 43.6 bits (98), Expect = 2e-06 Identities = 19/46 (41%), Positives = 25/46 (54%) Frame = +1 Query: 511 THLGGEDFDNRMVNHFVQEFKRTYXXXXXXXXXXXXXXXXXCERAR 648 THLGGEDFDNR+V + Q+FK+ + CERA+ Sbjct: 54 THLGGEDFDNRLVEYCTQDFKKKHKADISGNPRALRRLRTQCERAK 99 Score = 22.6 bits (46), Expect = 3.0 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +3 Query: 645 KRTLSSSTQAS 677 KRTLSS+TQAS Sbjct: 99 KRTLSSATQAS 109 >AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock protein 70 protein. Length = 195 Score = 84.2 bits (199), Expect = 9e-19 Identities = 39/52 (75%), Positives = 48/52 (92%) Frame = +2 Query: 353 INEPTAAAIAYGLDKKGTGERNVLIFYLGGGTFDVSILTIEDGIFEVKSTAG 508 INEPTAAAIAYGLDKKG E+N+L++ LGGGTFDVSILTI++G+FEV +T+G Sbjct: 1 INEPTAAAIAYGLDKKGA-EQNILVYDLGGGTFDVSILTIDNGVFEVVATSG 51 Score = 33.5 bits (73), Expect = 0.002 Identities = 11/24 (45%), Positives = 20/24 (83%) Frame = +1 Query: 511 THLGGEDFDNRMVNHFVQEFKRTY 582 THLGGEDFD +++++F++ K+ + Sbjct: 53 THLGGEDFDQKVMDYFIKMVKQKH 76 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 23.0 bits (47), Expect = 2.3 Identities = 14/42 (33%), Positives = 19/42 (45%) Frame = +3 Query: 126 DGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKT 251 D KPKI+ + ED+ E+ K K T + L KT Sbjct: 241 DKDKPKIEDVGEDEDEDTKKEDKKKKKTIKEKYTEDEELNKT 282 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 22.6 bits (46), Expect = 3.0 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +2 Query: 308 TKDAGTISGLNVLRIINEPTAA 373 TKDAG +S + ++N+P A Sbjct: 330 TKDAGLLSYPEICTLLNDPQNA 351 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 22.2 bits (45), Expect = 4.0 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = +1 Query: 469 HRGWYLRGEIHRRHTHLGGEDFDNRMVNH 555 H W ++ R + G+D+ MVNH Sbjct: 458 HEPWTAPEQVQRAAKCIIGKDYSLPMVNH 486 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 21.4 bits (43), Expect = 7.0 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +1 Query: 487 RGEIHRRHTHLGGEDF 534 RG + R THL +DF Sbjct: 467 RGSVFVRFTHLQNQDF 482 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,661 Number of Sequences: 336 Number of extensions: 3727 Number of successful extensions: 15 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17697850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -