BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021195 (566 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_39468| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.38 SB_28257| Best HMM Match : Gp-FAR-1 (HMM E-Value=3.2) 30 1.1 >SB_39468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1778 Score = 31.9 bits (69), Expect = 0.38 Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 2/53 (3%) Frame = +3 Query: 414 ERDVEHVGGERVE-CHE-RDSAAHNTASLKSMAQRPCTAPVWTCTTRTRDGVR 566 +R ++HV V+ CH R++A TA L MA P W+C T R+ VR Sbjct: 1331 QRKLKHVESRTVQLCHAVRENA---TALLPEMAASPAQGNAWSCGTAGRNHVR 1380 >SB_28257| Best HMM Match : Gp-FAR-1 (HMM E-Value=3.2) Length = 497 Score = 30.3 bits (65), Expect = 1.1 Identities = 17/40 (42%), Positives = 21/40 (52%) Frame = +3 Query: 447 VECHERDSAAHNTASLKSMAQRPCTAPVWTCTTRTRDGVR 566 V CHERD A +TA+L AQRP + RD V+ Sbjct: 281 VHCHERDETAASTATLP--AQRPSRISLMISRHALRDKVK 318 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.312 0.128 0.373 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,902,524 Number of Sequences: 59808 Number of extensions: 156048 Number of successful extensions: 380 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 371 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 380 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1337207630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits)
- SilkBase 1999-2023 -