BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021195 (566 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L32832-1|AAC14462.1| 3703|Homo sapiens zinc finger homeodomain p... 31 2.8 AC002044-1|AAC31674.1| 1190|Homo sapiens Alpha-fetoprotein enhan... 31 2.8 >L32832-1|AAC14462.1| 3703|Homo sapiens zinc finger homeodomain protein protein. Length = 3703 Score = 31.1 bits (67), Expect = 2.8 Identities = 16/50 (32%), Positives = 26/50 (52%) Frame = +3 Query: 360 PPSFRASQAAPRAQQWTSERDVEHVGGERVECHERDSAAHNTASLKSMAQ 509 PP R A+ ++ E DVE++ GE V ++ D +A+ SL + Q Sbjct: 105 PPPLREESASDTGEEGDEESDVENLAGEIV--YQPDGSAYIVESLSQLTQ 152 >AC002044-1|AAC31674.1| 1190|Homo sapiens Alpha-fetoprotein enhancer binding protein (3' partial) protein. Length = 1190 Score = 31.1 bits (67), Expect = 2.8 Identities = 16/50 (32%), Positives = 26/50 (52%) Frame = +3 Query: 360 PPSFRASQAAPRAQQWTSERDVEHVGGERVECHERDSAAHNTASLKSMAQ 509 PP R A+ ++ E DVE++ GE V ++ D +A+ SL + Q Sbjct: 105 PPPLREESASDTGEEGDEESDVENLAGEIV--YQPDGSAYIVESLSQLTQ 152 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.312 0.128 0.373 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 55,804,543 Number of Sequences: 237096 Number of extensions: 747460 Number of successful extensions: 1433 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1403 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1433 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 5759818212 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits)
- SilkBase 1999-2023 -