Bombyx BLAST Result against celegans

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV021195
         (566 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AC093703-3|AAL00866.2| 1319|Caenorhabditis elegans Hypothetical ...    29   3.1  

>AC093703-3|AAL00866.2| 1319|Caenorhabditis elegans Hypothetical
           protein Y20F4.4 protein.
          Length = 1319

 Score = 28.7 bits (61), Expect = 3.1
 Identities = 19/64 (29%), Positives = 28/64 (43%)
 Frame = +3

Query: 372 RASQAAPRAQQWTSERDVEHVGGERVECHERDSAAHNTASLKSMAQRPCTAPVWTCTTRT 551
           R+    PR+ Q+ SE   EH        HE  S A   A + + +Q    AP  + T+R 
Sbjct: 354 RSRATVPRSAQYRSEHQTEHARTGSSSHHESRSRAAAAAPVGASSQSKPPAP--SPTSRE 411

Query: 552 RDGV 563
            D +
Sbjct: 412 TDSI 415


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.312    0.128    0.373 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 8,337,928
Number of Sequences: 27780
Number of extensions: 105848
Number of successful extensions: 282
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 280
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 282
length of database: 12,740,198
effective HSP length: 77
effective length of database: 10,601,138
effective search space used: 1176726318
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.9 bits)