BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021194 (698 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578796-1|AAT07301.1| 437|Anopheles gambiae Gbb-60A protein. 27 0.43 AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. 26 0.99 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 23 9.2 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 23 9.2 AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 23 9.2 >AY578796-1|AAT07301.1| 437|Anopheles gambiae Gbb-60A protein. Length = 437 Score = 27.5 bits (58), Expect = 0.43 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +3 Query: 390 ATKLLKDILVIQKEIQTIKESYVTEDKLNEIKNELYNL 503 AT L I V QT+ E +T ++ EI+NE+ NL Sbjct: 31 ATSTLSGIYVDNGVGQTVLEDTLTYEEQQEIENEILNL 68 >AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. Length = 1376 Score = 26.2 bits (55), Expect = 0.99 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 1/56 (1%) Frame = -1 Query: 305 KKTDNIKKIAMHSAFPSRVLFRFEVVTDSNK-RLLAFSISSTEKDVEHIRTKLSSL 141 K+ + K A+ A + + + VT+ K L +S TEKD+E R +L +L Sbjct: 477 KRAVDESKSALSIAESELKICQHDEVTERRKLESLRYSYEETEKDLEEKRARLQTL 532 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 23.0 bits (47), Expect = 9.2 Identities = 8/16 (50%), Positives = 14/16 (87%) Frame = -1 Query: 224 DSNKRLLAFSISSTEK 177 DSN++++ FS +STE+ Sbjct: 505 DSNEQIITFSTASTEQ 520 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 23.0 bits (47), Expect = 9.2 Identities = 8/16 (50%), Positives = 14/16 (87%) Frame = -1 Query: 224 DSNKRLLAFSISSTEK 177 DSN++++ FS +STE+ Sbjct: 506 DSNEQIITFSTASTEQ 521 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 23.0 bits (47), Expect = 9.2 Identities = 10/19 (52%), Positives = 16/19 (84%) Frame = +1 Query: 202 AKSLLFESVTTSKRKRTRE 258 AKSLL +++ TSKR++ +E Sbjct: 403 AKSLLEKAIRTSKRQQFQE 421 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 658,391 Number of Sequences: 2352 Number of extensions: 12552 Number of successful extensions: 15 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71086350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -