BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021193 (767 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_1073 - 33895608-33895880,33896133-33896180,33896273-338965... 30 1.8 02_03_0390 + 18448671-18448889,18449567-18449632,18449702-184497... 30 2.3 11_02_0071 - 8009785-8010012,8010456-8010974,8011429-8011611 29 3.1 12_01_0977 - 9900073-9900521,9900594-9900698,9900770-9900959,990... 29 5.4 07_03_0631 + 20104332-20106802,20106904-20107030,20107352-201074... 28 7.1 02_05_0678 - 30814192-30814310,30814636-30814660,30814948-308150... 28 7.1 08_01_0404 - 3590296-3590409,3590529-3590819,3592414-3592461,359... 28 9.4 >02_05_1073 - 33895608-33895880,33896133-33896180,33896273-33896509, 33897233-33897269,33898603-33898913 Length = 301 Score = 30.3 bits (65), Expect = 1.8 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = -1 Query: 386 LHIAIVQGIRVVFSVGITILFEILR 312 LH AI+ GIRV++ V +T+ F+I + Sbjct: 171 LHSAILSGIRVLYPVKVTLWFDIFK 195 >02_03_0390 + 18448671-18448889,18449567-18449632,18449702-18449761, 18449864-18449959,18452287-18452447,18452669-18452790, 18452872-18453239,18453653-18453739,18453835-18453969, 18454349-18454471,18454771-18454854,18455023-18455187, 18455310-18455486,18455660-18455773,18455912-18456016, 18457056-18457174,18457244-18457385,18457461-18457555, 18457757-18457862,18458125-18458204,18458285-18458461, 18459828-18459912,18460024-18460104,18460208-18460351, 18460468-18460563,18460654-18460854,18461462-18461895, 18462417-18462478,18462622-18462872,18462956-18463030, 18463110-18463300,18463696-18463867,18463956-18464020, 18464646-18464778,18464861-18464962,18465047-18465130, 18465656-18465730,18465818-18465877,18465967-18466223, 18466560-18466608,18466781-18466941,18467013-18467079, 18467174-18467299,18467422-18467592,18468566-18468769, 18469059-18469165,18469608-18469737,18469774-18469959, 18470704-18470742 Length = 2202 Score = 29.9 bits (64), Expect = 2.3 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = +3 Query: 81 LTRNNTNKYVKTLNCVPNKDLFNLNSDCCVAF 176 + RNNTN +TLN NK L+ +S+C + F Sbjct: 952 VARNNTNDQYQTLNDPVNK-LYTTHSECSIEF 982 >11_02_0071 - 8009785-8010012,8010456-8010974,8011429-8011611 Length = 309 Score = 29.5 bits (63), Expect = 3.1 Identities = 14/46 (30%), Positives = 22/46 (47%) Frame = -1 Query: 755 GITCQCYCHPFYCQIKSVTVFGVFVRDIKNVFVVTFGILPGLWQCP 618 G+ + + PF ++ V V +RD++N VV PG CP Sbjct: 187 GLRIKTWGKPFAGRVSGVRFANVAMRDVQNPIVVDQNYCPGNVNCP 232 >12_01_0977 - 9900073-9900521,9900594-9900698,9900770-9900959, 9901035-9901093,9901297-9901688,9901770-9902059, 9902146-9903030 Length = 789 Score = 28.7 bits (61), Expect = 5.4 Identities = 16/52 (30%), Positives = 29/52 (55%), Gaps = 6/52 (11%) Frame = +3 Query: 366 LNDSDMKSVYGEELFNKLHILPDPLMKN------LGDTLAMNMTEVKKSRVK 503 LN+S ++ E+F+KL + PD KN +G ++A+ MT+ R++ Sbjct: 680 LNNSGPSALDATEIFDKLRVAPDVYFKNIKKAGSMGASMALAMTKSLYPRIE 731 >07_03_0631 + 20104332-20106802,20106904-20107030,20107352-20107479, 20108771-20109083 Length = 1012 Score = 28.3 bits (60), Expect = 7.1 Identities = 17/57 (29%), Positives = 24/57 (42%) Frame = +3 Query: 348 KYHTDALNDSDMKSVYGEELFNKLHILPDPLMKNLGDTLAMNMTEVKKSRVKRINWW 518 K+H L D G+++ KLH LP + +G L + E V NWW Sbjct: 323 KHHAFGLTRKDSLESIGDKIAGKLHGLP-LSAEVIGRLLRTKLDEDHWRNVCESNWW 378 >02_05_0678 - 30814192-30814310,30814636-30814660,30814948-30815039, 30815119-30815170 Length = 95 Score = 28.3 bits (60), Expect = 7.1 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = -3 Query: 288 GSKNSFSRNFFSLHTIHY*SLFLYQAKVCEGICNTFP 178 GSK+ FS N L Y F A EGIC FP Sbjct: 2 GSKDGFSNNKL-LDDFGYNPTFKDDATAAEGICTVFP 37 >08_01_0404 - 3590296-3590409,3590529-3590819,3592414-3592461, 3592559-3592795,3593668-3593704,3594311-3594627 Length = 347 Score = 27.9 bits (59), Expect = 9.4 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = -1 Query: 386 LHIAIVQGIRVVFSVGITILFEILRIV 306 LH AI+ G+RVV V T F+I + V Sbjct: 173 LHSAILSGLRVVCHVNFTFCFDIYKNV 199 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,544,685 Number of Sequences: 37544 Number of extensions: 407275 Number of successful extensions: 948 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 922 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 947 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2063219900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -