BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021193 (767 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 23 3.1 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 23 3.1 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 23 3.1 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 23 3.1 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 23 3.1 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 23 3.1 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 23 3.1 AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly pro... 23 3.1 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 23 3.1 DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 21 9.5 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 21 9.5 AF393497-1|AAL60422.1| 143|Apis mellifera odorant binding prote... 21 9.5 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.0 bits (47), Expect = 3.1 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +3 Query: 648 KSDYKNILNITDKNTEH 698 + + KNILN T++ TEH Sbjct: 173 REEIKNILNKTNEITEH 189 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.0 bits (47), Expect = 3.1 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +3 Query: 648 KSDYKNILNITDKNTEH 698 + + KNILN T++ TEH Sbjct: 173 REEIKNILNKTNEITEH 189 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.0 bits (47), Expect = 3.1 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +3 Query: 648 KSDYKNILNITDKNTEH 698 + + KNILN T++ TEH Sbjct: 173 REEIKNILNKTNEITEH 189 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.0 bits (47), Expect = 3.1 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +3 Query: 648 KSDYKNILNITDKNTEH 698 + + KNILN T++ TEH Sbjct: 173 REEIKNILNKTNEITEH 189 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.0 bits (47), Expect = 3.1 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +3 Query: 648 KSDYKNILNITDKNTEH 698 + + KNILN T++ TEH Sbjct: 173 REEIKNILNKTNEITEH 189 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.0 bits (47), Expect = 3.1 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +3 Query: 648 KSDYKNILNITDKNTEH 698 + + KNILN T++ TEH Sbjct: 173 REEIKNILNKTNEITEH 189 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 23.0 bits (47), Expect = 3.1 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +3 Query: 648 KSDYKNILNITDKNTEH 698 + + KNILN T++ TEH Sbjct: 173 REEIKNILNKTNEITEH 189 >AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly protein 8 protein. Length = 416 Score = 23.0 bits (47), Expect = 3.1 Identities = 15/61 (24%), Positives = 23/61 (37%), Gaps = 3/61 (4%) Frame = +3 Query: 6 TFIVTME---PLSDFNFETNKSTSNKDFLTRNNTNKYVKTLNCVPNKDLFNLNSDCCVAF 176 TF++ M+ S N TNK+ + L + K NC + + D C Sbjct: 74 TFVIIMKFNGVPSSLNVITNKTGNGGPLLAPYPDWTWAKNENCSGITSAYKIEIDMCDRL 133 Query: 177 W 179 W Sbjct: 134 W 134 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 23.0 bits (47), Expect = 3.1 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +3 Query: 648 KSDYKNILNITDKNTEH 698 + + KNILN T++ TEH Sbjct: 173 REEIKNILNKTNEITEH 189 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 21.4 bits (43), Expect = 9.5 Identities = 15/49 (30%), Positives = 19/49 (38%) Frame = +1 Query: 553 SGMMSTLAGVMFRSRNRQISIQGHCHKPGRIPKVTTKTFLISRTKTPNT 699 SG S +G RN + I H PG I ++K K P T Sbjct: 35 SGQRSVSSGFRSSLRNYKTLISSHDELPGHINCDSSKFEEDLMNKLPTT 83 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 21.4 bits (43), Expect = 9.5 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -3 Query: 666 CFCSHFWNPARFVAVSLDRYLTVS 595 C S +N VA+S+DRY+ V+ Sbjct: 269 CSTSSIFN---LVAISIDRYIAVT 289 >AF393497-1|AAL60422.1| 143|Apis mellifera odorant binding protein ASP5 protein. Length = 143 Score = 21.4 bits (43), Expect = 9.5 Identities = 10/31 (32%), Positives = 13/31 (41%) Frame = +3 Query: 189 CRYPHRPSPDIRKDFNSVSCATKRNFSKMNF 281 CR D +K + V C K+N K F Sbjct: 112 CRNEEYTGDDCQKTYQYVQCHYKQNPEKFFF 142 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 219,233 Number of Sequences: 438 Number of extensions: 5448 Number of successful extensions: 19 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24032646 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -