BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021191 (785 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 25 1.1 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 22 5.6 AB208108-1|BAE72140.1| 92|Apis mellifera Broad complex zinc fi... 21 9.8 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 24.6 bits (51), Expect = 1.1 Identities = 17/52 (32%), Positives = 23/52 (44%) Frame = +1 Query: 457 SLSRQNCAECSYHGSRVLNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYG 612 SL R+ + + VL Q +A K A + N II+EPT YG Sbjct: 332 SLRRKRQKINNSQNALVLRHVQAEAEKHAAMLYQYNFNIIISEPTERISPYG 383 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 22.2 bits (45), Expect = 5.6 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 751 HFPSGCRRRWISPRRYHP 698 H P+G + WI+ RY P Sbjct: 794 HTPNGIVKTWIAHDRYLP 811 >AB208108-1|BAE72140.1| 92|Apis mellifera Broad complex zinc finger domain-Z3 isoform protein. Length = 92 Score = 21.4 bits (43), Expect = 9.8 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -3 Query: 66 PFCIFNQSCYLFLKQ 22 P+C N SCY LK+ Sbjct: 9 PYCRRNFSCYYSLKR 23 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 234,876 Number of Sequences: 438 Number of extensions: 5752 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24760908 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -