BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021188 (677 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC010846-1|AAH10846.2| 436|Homo sapiens STAM binding protein-li... 31 2.8 AL157394-5|CAI13863.1| 270|Homo sapiens novel Mov34/MPN/PAD-1 f... 31 2.8 AL157394-4|CAI13862.1| 461|Homo sapiens novel Mov34/MPN/PAD-1 f... 31 2.8 AL157394-3|CAI13861.1| 436|Homo sapiens novel Mov34/MPN/PAD-1 f... 31 2.8 AB037794-1|BAA92611.1| 463|Homo sapiens KIAA1373 protein protein. 31 2.8 AB010120-1|BAC77766.1| 436|Homo sapiens AMSH-LP protein. 31 2.8 M99487-1|AAA60209.1| 750|Homo sapiens prostate- specific membra... 30 6.6 EF488812-1|ABO93403.1| 735|Homo sapiens prostate specific membr... 30 6.6 EF488811-1|ABO93402.2| 704|Homo sapiens prostate specific membr... 30 6.6 BC108719-1|AAI08720.1| 671|Homo sapiens FOLH1 protein protein. 30 6.6 BC025672-1|AAH25672.1| 719|Homo sapiens folate hydrolase (prost... 30 6.6 AY544126-1|AAT11157.1| 442|Homo sapiens growth-inhibiting prote... 30 6.6 AY101595-1|AAM34479.1| 750|Homo sapiens prostate-specific membr... 30 6.6 AF261715-1|AAG29102.1| 442|Homo sapiens prostate-specific membr... 30 6.6 AF176574-1|AAD51121.1| 750|Homo sapiens folylpoly-gamma-glutama... 30 6.6 AF007544-1|AAC83972.1| 750|Homo sapiens prostate-specific membr... 30 6.6 L29016-1|AAA36448.1| 386|Homo sapiens prostanoid IP receptor pr... 30 8.7 D38127-1|BAA07325.1| 386|Homo sapiens prostacyclin receptor pro... 30 8.7 D29634-1|BAA06110.1| 386|Homo sapiens prostacyclin receptor pro... 30 8.7 D25418-1|BAA05008.1| 386|Homo sapiens prostacyclin receptor pro... 30 8.7 BC110342-1|AAI10343.1| 386|Homo sapiens prostaglandin I2 (prost... 30 8.7 BC075814-1|AAH75814.1| 386|Homo sapiens prostaglandin I2 (prost... 30 8.7 BC021209-1|AAH21209.1| 966|Homo sapiens RAI1 protein protein. 30 8.7 AY242134-1|AAO92301.1| 386|Homo sapiens prostaglandin I2 (prost... 30 8.7 AY172136-1|AAO31738.1| 1906|Homo sapiens retinoic acid induced 1... 30 8.7 AJ271791-1|CAC20424.1| 1800|Homo sapiens retinoid-acid induced p... 30 8.7 AJ271790-1|CAC20423.1| 1862|Homo sapiens retinoid-acid induced p... 30 8.7 AB058723-1|BAB47449.1| 1644|Homo sapiens KIAA1820 protein protein. 30 8.7 >BC010846-1|AAH10846.2| 436|Homo sapiens STAM binding protein-like 1 protein. Length = 436 Score = 31.5 bits (68), Expect = 2.8 Identities = 16/47 (34%), Positives = 26/47 (55%) Frame = +1 Query: 487 GLCKTCFATYQNTSSFHSEKMTPHKYTSTVQSNYSAHTPGYNVGQSP 627 G +CF+T+QN S + P+K +T NY++H+P N +P Sbjct: 208 GSALSCFSTHQNNSLLNVFADQPNKSDAT---NYASHSPPVNRALTP 251 >AL157394-5|CAI13863.1| 270|Homo sapiens novel Mov34/MPN/PAD-1 family domain containing protein (FLJ31524) protein. Length = 270 Score = 31.5 bits (68), Expect = 2.8 Identities = 16/47 (34%), Positives = 26/47 (55%) Frame = +1 Query: 487 GLCKTCFATYQNTSSFHSEKMTPHKYTSTVQSNYSAHTPGYNVGQSP 627 G +CF+T+QN S + P+K +T NY++H+P N +P Sbjct: 42 GSALSCFSTHQNNSLLNVFADQPNKSDAT---NYASHSPPVNRALTP 85 >AL157394-4|CAI13862.1| 461|Homo sapiens novel Mov34/MPN/PAD-1 family domain containing protein (FLJ31524) protein. Length = 461 Score = 31.5 bits (68), Expect = 2.8 Identities = 16/47 (34%), Positives = 26/47 (55%) Frame = +1 Query: 487 GLCKTCFATYQNTSSFHSEKMTPHKYTSTVQSNYSAHTPGYNVGQSP 627 G +CF+T+QN S + P+K +T NY++H+P N +P Sbjct: 208 GSALSCFSTHQNNSLLNVFADQPNKSDAT---NYASHSPPVNRALTP 251 >AL157394-3|CAI13861.1| 436|Homo sapiens novel Mov34/MPN/PAD-1 family domain containing protein (FLJ31524) protein. Length = 436 Score = 31.5 bits (68), Expect = 2.8 Identities = 16/47 (34%), Positives = 26/47 (55%) Frame = +1 Query: 487 GLCKTCFATYQNTSSFHSEKMTPHKYTSTVQSNYSAHTPGYNVGQSP 627 G +CF+T+QN S + P+K +T NY++H+P N +P Sbjct: 208 GSALSCFSTHQNNSLLNVFADQPNKSDAT---NYASHSPPVNRALTP 251 >AB037794-1|BAA92611.1| 463|Homo sapiens KIAA1373 protein protein. Length = 463 Score = 31.5 bits (68), Expect = 2.8 Identities = 16/47 (34%), Positives = 26/47 (55%) Frame = +1 Query: 487 GLCKTCFATYQNTSSFHSEKMTPHKYTSTVQSNYSAHTPGYNVGQSP 627 G +CF+T+QN S + P+K +T NY++H+P N +P Sbjct: 210 GSALSCFSTHQNNSLLNVFADQPNKSDAT---NYASHSPPVNRALTP 253 >AB010120-1|BAC77766.1| 436|Homo sapiens AMSH-LP protein. Length = 436 Score = 31.5 bits (68), Expect = 2.8 Identities = 16/47 (34%), Positives = 26/47 (55%) Frame = +1 Query: 487 GLCKTCFATYQNTSSFHSEKMTPHKYTSTVQSNYSAHTPGYNVGQSP 627 G +CF+T+QN S + P+K +T NY++H+P N +P Sbjct: 208 GSALSCFSTHQNNSLLNVFADQPNKSDAT---NYASHSPPVNRALTP 251 >M99487-1|AAA60209.1| 750|Homo sapiens prostate- specific membrane antigen protein. Length = 750 Score = 30.3 bits (65), Expect = 6.6 Identities = 17/36 (47%), Positives = 20/36 (55%) Frame = +2 Query: 62 RIEILSSKNGFEVFFENLCDISRVSRYYRNVEYTLF 169 RI L S N FEVFF+ L S +RY +N E F Sbjct: 511 RISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKF 546 >EF488812-1|ABO93403.1| 735|Homo sapiens prostate specific membrane antigen variant F protein. Length = 735 Score = 30.3 bits (65), Expect = 6.6 Identities = 17/36 (47%), Positives = 20/36 (55%) Frame = +2 Query: 62 RIEILSSKNGFEVFFENLCDISRVSRYYRNVEYTLF 169 RI L S N FEVFF+ L S +RY +N E F Sbjct: 496 RISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKF 531 >EF488811-1|ABO93402.2| 704|Homo sapiens prostate specific membrane antigen variant E protein. Length = 704 Score = 30.3 bits (65), Expect = 6.6 Identities = 17/36 (47%), Positives = 20/36 (55%) Frame = +2 Query: 62 RIEILSSKNGFEVFFENLCDISRVSRYYRNVEYTLF 169 RI L S N FEVFF+ L S +RY +N E F Sbjct: 496 RISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKF 531 >BC108719-1|AAI08720.1| 671|Homo sapiens FOLH1 protein protein. Length = 671 Score = 30.3 bits (65), Expect = 6.6 Identities = 17/36 (47%), Positives = 20/36 (55%) Frame = +2 Query: 62 RIEILSSKNGFEVFFENLCDISRVSRYYRNVEYTLF 169 RI L S N FEVFF+ L S +RY +N E F Sbjct: 432 RISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKF 467 >BC025672-1|AAH25672.1| 719|Homo sapiens folate hydrolase (prostate-specific membrane antigen) 1 protein. Length = 719 Score = 30.3 bits (65), Expect = 6.6 Identities = 17/36 (47%), Positives = 20/36 (55%) Frame = +2 Query: 62 RIEILSSKNGFEVFFENLCDISRVSRYYRNVEYTLF 169 RI L S N FEVFF+ L S +RY +N E F Sbjct: 511 RISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKF 546 >AY544126-1|AAT11157.1| 442|Homo sapiens growth-inhibiting protein 26 protein. Length = 442 Score = 30.3 bits (65), Expect = 6.6 Identities = 17/36 (47%), Positives = 20/36 (55%) Frame = +2 Query: 62 RIEILSSKNGFEVFFENLCDISRVSRYYRNVEYTLF 169 RI L S N FEVFF+ L S +RY +N E F Sbjct: 203 RISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKF 238 >AY101595-1|AAM34479.1| 750|Homo sapiens prostate-specific membrane antigen protein. Length = 750 Score = 30.3 bits (65), Expect = 6.6 Identities = 17/36 (47%), Positives = 20/36 (55%) Frame = +2 Query: 62 RIEILSSKNGFEVFFENLCDISRVSRYYRNVEYTLF 169 RI L S N FEVFF+ L S +RY +N E F Sbjct: 511 RISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKF 546 >AF261715-1|AAG29102.1| 442|Homo sapiens prostate-specific membrane antigen-like protein protein. Length = 442 Score = 30.3 bits (65), Expect = 6.6 Identities = 17/36 (47%), Positives = 20/36 (55%) Frame = +2 Query: 62 RIEILSSKNGFEVFFENLCDISRVSRYYRNVEYTLF 169 RI L S N FEVFF+ L S +RY +N E F Sbjct: 203 RISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKF 238 >AF176574-1|AAD51121.1| 750|Homo sapiens folylpoly-gamma-glutamate carboxypeptidase protein. Length = 750 Score = 30.3 bits (65), Expect = 6.6 Identities = 17/36 (47%), Positives = 20/36 (55%) Frame = +2 Query: 62 RIEILSSKNGFEVFFENLCDISRVSRYYRNVEYTLF 169 RI L S N FEVFF+ L S +RY +N E F Sbjct: 511 RISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKF 546 >AF007544-1|AAC83972.1| 750|Homo sapiens prostate-specific membrane antigen protein. Length = 750 Score = 30.3 bits (65), Expect = 6.6 Identities = 17/36 (47%), Positives = 20/36 (55%) Frame = +2 Query: 62 RIEILSSKNGFEVFFENLCDISRVSRYYRNVEYTLF 169 RI L S N FEVFF+ L S +RY +N E F Sbjct: 511 RISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKF 546 >L29016-1|AAA36448.1| 386|Homo sapiens prostanoid IP receptor protein. Length = 386 Score = 29.9 bits (64), Expect = 8.7 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -1 Query: 383 EETQFCPGSWCDHRATWS 330 + Q+CPGSWC R W+ Sbjct: 160 QHQQYCPGSWCFLRMRWA 177 >D38127-1|BAA07325.1| 386|Homo sapiens prostacyclin receptor protein. Length = 386 Score = 29.9 bits (64), Expect = 8.7 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -1 Query: 383 EETQFCPGSWCDHRATWS 330 + Q+CPGSWC R W+ Sbjct: 160 QHQQYCPGSWCFLRMRWA 177 >D29634-1|BAA06110.1| 386|Homo sapiens prostacyclin receptor protein. Length = 386 Score = 29.9 bits (64), Expect = 8.7 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -1 Query: 383 EETQFCPGSWCDHRATWS 330 + Q+CPGSWC R W+ Sbjct: 160 QHQQYCPGSWCFLRMRWA 177 >D25418-1|BAA05008.1| 386|Homo sapiens prostacyclin receptor protein. Length = 386 Score = 29.9 bits (64), Expect = 8.7 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -1 Query: 383 EETQFCPGSWCDHRATWS 330 + Q+CPGSWC R W+ Sbjct: 160 QHQQYCPGSWCFLRMRWA 177 >BC110342-1|AAI10343.1| 386|Homo sapiens prostaglandin I2 (prostacyclin) receptor (IP) protein. Length = 386 Score = 29.9 bits (64), Expect = 8.7 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -1 Query: 383 EETQFCPGSWCDHRATWS 330 + Q+CPGSWC R W+ Sbjct: 160 QHQQYCPGSWCFLRMRWA 177 >BC075814-1|AAH75814.1| 386|Homo sapiens prostaglandin I2 (prostacyclin) receptor (IP) protein. Length = 386 Score = 29.9 bits (64), Expect = 8.7 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -1 Query: 383 EETQFCPGSWCDHRATWS 330 + Q+CPGSWC R W+ Sbjct: 160 QHQQYCPGSWCFLRMRWA 177 >BC021209-1|AAH21209.1| 966|Homo sapiens RAI1 protein protein. Length = 966 Score = 29.9 bits (64), Expect = 8.7 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +1 Query: 550 TPHKYTSTVQSNYSAHTPGYNVGQSPGYGRT 642 TP +Y T + S+H+P +VG+SP Y T Sbjct: 330 TPEQYYQTFSPS-SSHSPARSVGRSPSYSST 359 >AY242134-1|AAO92301.1| 386|Homo sapiens prostaglandin I2 (prostacyclin) receptor protein. Length = 386 Score = 29.9 bits (64), Expect = 8.7 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -1 Query: 383 EETQFCPGSWCDHRATWS 330 + Q+CPGSWC R W+ Sbjct: 160 QHQQYCPGSWCFLRMRWA 177 >AY172136-1|AAO31738.1| 1906|Homo sapiens retinoic acid induced 1 protein. Length = 1906 Score = 29.9 bits (64), Expect = 8.7 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +1 Query: 550 TPHKYTSTVQSNYSAHTPGYNVGQSPGYGRT 642 TP +Y T + S+H+P +VG+SP Y T Sbjct: 330 TPEQYYQTFSPS-SSHSPARSVGRSPSYSST 359 >AJ271791-1|CAC20424.1| 1800|Homo sapiens retinoid-acid induced protein 1 protein. Length = 1800 Score = 29.9 bits (64), Expect = 8.7 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +1 Query: 550 TPHKYTSTVQSNYSAHTPGYNVGQSPGYGRT 642 TP +Y T + S+H+P +VG+SP Y T Sbjct: 308 TPEQYYQTFSPS-SSHSPARSVGRSPSYSST 337 >AJ271790-1|CAC20423.1| 1862|Homo sapiens retinoid-acid induced protein 1 protein. Length = 1862 Score = 29.9 bits (64), Expect = 8.7 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +1 Query: 550 TPHKYTSTVQSNYSAHTPGYNVGQSPGYGRT 642 TP +Y T + S+H+P +VG+SP Y T Sbjct: 308 TPEQYYQTFSPS-SSHSPARSVGRSPSYSST 337 >AB058723-1|BAB47449.1| 1644|Homo sapiens KIAA1820 protein protein. Length = 1644 Score = 29.9 bits (64), Expect = 8.7 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +1 Query: 550 TPHKYTSTVQSNYSAHTPGYNVGQSPGYGRT 642 TP +Y T + S+H+P +VG+SP Y T Sbjct: 334 TPEQYYQTFSPS-SSHSPARSVGRSPSYSST 363 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 91,003,212 Number of Sequences: 237096 Number of extensions: 1973837 Number of successful extensions: 5044 Number of sequences better than 10.0: 28 Number of HSP's better than 10.0 without gapping: 4752 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5044 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 7671262118 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -