BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021184 (706 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 25 0.79 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 23 1.8 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 23 2.4 EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglu... 22 4.2 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 24.6 bits (51), Expect = 0.79 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 262 RSPGPSAVGRWKRAARHVAY 321 ++PGP G + RAA +AY Sbjct: 1660 KAPGPGQAGEYTRAAGFLAY 1679 Score = 23.4 bits (48), Expect = 1.8 Identities = 14/35 (40%), Positives = 19/35 (54%), Gaps = 3/35 (8%) Frame = +1 Query: 253 DRG---RSPGPSAVGRWKRAARHVAYAKWRERLLK 348 DRG +S GP G + RA +AY + ER+ K Sbjct: 2577 DRGLNAKSYGPGEAGEFTRAGGFLAYYEICERVKK 2611 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 23.4 bits (48), Expect = 1.8 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +3 Query: 15 DCTLGWCAVW 44 DC LGW VW Sbjct: 711 DCDLGWVEVW 720 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 23.0 bits (47), Expect = 2.4 Identities = 13/33 (39%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -3 Query: 134 PSPRAPAEL*AAETR--FSRRVRATTREHRTGP 42 PSP AP+EL A ++R + V ++T + GP Sbjct: 72 PSPPAPSELPALKSRKLNNNNVVSSTNQEIRGP 104 >EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglucosaminidase NAG3 protein. Length = 582 Score = 22.2 bits (45), Expect = 4.2 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -2 Query: 420 RPCLQHGHQGL 388 RP +QHGHQ L Sbjct: 494 RPWVQHGHQEL 504 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 186,715 Number of Sequences: 336 Number of extensions: 4507 Number of successful extensions: 9 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18634795 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -