BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021180 (725 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetyla... 25 0.83 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 21 7.7 >EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetylase 1 protein. Length = 534 Score = 24.6 bits (51), Expect = 0.83 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -1 Query: 353 GEFFRLLAGERDGETLFLVCT 291 GE+FRL+AGE D + CT Sbjct: 46 GEWFRLVAGEGDNCRDVIQCT 66 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 21.4 bits (43), Expect = 7.7 Identities = 11/35 (31%), Positives = 16/35 (45%) Frame = +2 Query: 296 RQGKEFRRLVLPPEVEKTPLEQGRYLLRILLKNRP 400 RQG R+ LPP + + Y++ L N P Sbjct: 630 RQGLLHRQFNLPPAKDTIAVPNNGYVVLRLRANNP 664 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 153,012 Number of Sequences: 336 Number of extensions: 3146 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19363530 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -