BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021171 (700 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nu... 23 2.4 AM292376-1|CAL23188.2| 402|Tribolium castaneum gustatory recept... 23 3.2 AM292332-1|CAL23144.2| 344|Tribolium castaneum gustatory recept... 23 3.2 >AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nuclear receptor protein. Length = 407 Score = 23.0 bits (47), Expect = 2.4 Identities = 9/28 (32%), Positives = 13/28 (46%) Frame = +3 Query: 345 RCSYCNRRKWLTSGCLRKWIKPNSMECK 428 RC YC +K L G R+ ++ K Sbjct: 137 RCQYCRYQKCLNMGMKREAVQEERQRTK 164 >AM292376-1|CAL23188.2| 402|Tribolium castaneum gustatory receptor candidate 55 protein. Length = 402 Score = 22.6 bits (46), Expect = 3.2 Identities = 12/52 (23%), Positives = 24/52 (46%) Frame = -1 Query: 532 YKFIGI*RELGSGIRIASTISIFVSLFLSILRCKCLHSIEFGLIHLRRHPLV 377 YK + +++ S + +SI VSLF + + L+ + G P++ Sbjct: 238 YKLTSVMQKINSAFSVQLLVSIGVSLFDVLFQAYYLYYVATGKASFVTVPMI 289 >AM292332-1|CAL23144.2| 344|Tribolium castaneum gustatory receptor candidate 11 protein. Length = 344 Score = 22.6 bits (46), Expect = 3.2 Identities = 12/52 (23%), Positives = 24/52 (46%) Frame = -1 Query: 532 YKFIGI*RELGSGIRIASTISIFVSLFLSILRCKCLHSIEFGLIHLRRHPLV 377 YK + +++ S + +SI VSLF + + L+ + G P++ Sbjct: 238 YKLTSVMQKINSAFSVQLLVSIGVSLFDVLFQAYYLYYVATGKASFVTVPMI 289 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 153,689 Number of Sequences: 336 Number of extensions: 3216 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18426585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -