BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021167 (718 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.) 143 1e-34 SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.) 143 1e-34 SB_56| Best HMM Match : Actin (HMM E-Value=0) 143 1e-34 SB_56628| Best HMM Match : Actin (HMM E-Value=0) 143 1e-34 SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.) 142 3e-34 SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.) 139 2e-33 SB_13344| Best HMM Match : Actin (HMM E-Value=1.5e-07) 123 1e-28 SB_54| Best HMM Match : Actin (HMM E-Value=0) 83 2e-16 SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07) 52 6e-07 SB_26136| Best HMM Match : Actin (HMM E-Value=7.2e-10) 44 9e-05 SB_49385| Best HMM Match : Actin (HMM E-Value=0.00022) 36 0.033 SB_22343| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_38098| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.40 SB_27551| Best HMM Match : rve (HMM E-Value=6.3e-25) 31 0.71 SB_6618| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.71 SB_20812| Best HMM Match : rve (HMM E-Value=1.2e-25) 31 0.93 SB_58386| Best HMM Match : rve (HMM E-Value=8.6e-26) 31 0.93 SB_33253| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.93 SB_59599| Best HMM Match : rve (HMM E-Value=1.69557e-43) 31 1.2 SB_56732| Best HMM Match : rve (HMM E-Value=0.0016) 31 1.2 SB_51082| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_45111| Best HMM Match : rve (HMM E-Value=1.2e-24) 31 1.2 SB_35781| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_34804| Best HMM Match : rve (HMM E-Value=1.2e-24) 31 1.2 SB_30663| Best HMM Match : rve (HMM E-Value=3.3e-25) 31 1.2 SB_20671| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_16139| Best HMM Match : rve (HMM E-Value=3.6e-21) 31 1.2 SB_11605| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_7864| Best HMM Match : rve (HMM E-Value=2.9e-23) 31 1.2 SB_42815| Best HMM Match : rve (HMM E-Value=0.00022) 31 1.2 SB_41315| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_39511| Best HMM Match : rve (HMM E-Value=0.0016) 31 1.2 SB_31260| Best HMM Match : rve (HMM E-Value=5.2e-25) 31 1.2 SB_2799| Best HMM Match : rve (HMM E-Value=7.8e-26) 31 1.2 SB_22949| Best HMM Match : rve (HMM E-Value=1.2e-19) 30 1.6 SB_11501| Best HMM Match : rve (HMM E-Value=3.8e-11) 30 1.6 SB_39041| Best HMM Match : rve (HMM E-Value=2.3e-10) 30 2.2 SB_30721| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_28997| Best HMM Match : rve (HMM E-Value=2.3e-10) 30 2.2 SB_41148| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_1624| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_48528| Best HMM Match : Extensin_2 (HMM E-Value=1) 29 3.8 SB_39712| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_35875| Best HMM Match : RVT_1 (HMM E-Value=5.2e-24) 29 3.8 SB_149| Best HMM Match : rve (HMM E-Value=6.3e-20) 29 3.8 SB_37044| Best HMM Match : rve (HMM E-Value=4.1e-07) 29 3.8 SB_20293| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_9849| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_2550| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_25899| Best HMM Match : Ribonuc_2-5A (HMM E-Value=0) 29 5.0 SB_46270| Best HMM Match : rve (HMM E-Value=1.2e-09) 29 5.0 SB_15486| Best HMM Match : rve (HMM E-Value=1.2e-09) 29 5.0 SB_28024| Best HMM Match : RVT_1 (HMM E-Value=0) 28 6.6 SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.7 SB_37543| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.7 SB_20960| Best HMM Match : Neuralized (HMM E-Value=3.9) 28 8.7 >SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 143 bits (346), Expect = 1e-34 Identities = 66/70 (94%), Positives = 68/70 (97%) Frame = -2 Query: 717 ASSSSLEKSYELPDGQVITIGNERFRCPEALFHPSFLGMEACGIHETTYNSIMKCDVDIR 538 ASSSSLEKSYELPDGQVITIGNERFRCPEA+F PSFLGME+ GIHETTYNSIMKCDVDIR Sbjct: 194 ASSSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIR 253 Query: 537 KDLYANTVLS 508 KDLYANTVLS Sbjct: 254 KDLYANTVLS 263 Score = 112 bits (270), Expect = 2e-25 Identities = 53/55 (96%), Positives = 54/55 (98%) Frame = -1 Query: 508 GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 344 GGTTMYPGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQM Sbjct: 264 GGTTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 318 Score = 44.4 bits (100), Expect = 9e-05 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = -3 Query: 341 ISKQEYDESGPSIVHRKCF 285 ISKQEYDESGP+IVHRKCF Sbjct: 320 ISKQEYDESGPAIVHRKCF 338 >SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 143 bits (346), Expect = 1e-34 Identities = 66/70 (94%), Positives = 68/70 (97%) Frame = -2 Query: 717 ASSSSLEKSYELPDGQVITIGNERFRCPEALFHPSFLGMEACGIHETTYNSIMKCDVDIR 538 ASSSSLEKSYELPDGQVITIGNERFRCPEA+F PSFLGME+ GIHETTYNSIMKCDVDIR Sbjct: 232 ASSSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIR 291 Query: 537 KDLYANTVLS 508 KDLYANTVLS Sbjct: 292 KDLYANTVLS 301 Score = 111 bits (267), Expect = 5e-25 Identities = 52/55 (94%), Positives = 54/55 (98%) Frame = -1 Query: 508 GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 344 GG+TMYPGIADRMQKEIT+LAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQM Sbjct: 302 GGSTMYPGIADRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 356 Score = 45.6 bits (103), Expect = 4e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -3 Query: 341 ISKQEYDESGPSIVHRKCF 285 ISKQEYDESGPSIVHRKCF Sbjct: 358 ISKQEYDESGPSIVHRKCF 376 >SB_56| Best HMM Match : Actin (HMM E-Value=0) Length = 375 Score = 143 bits (346), Expect = 1e-34 Identities = 66/70 (94%), Positives = 68/70 (97%) Frame = -2 Query: 717 ASSSSLEKSYELPDGQVITIGNERFRCPEALFHPSFLGMEACGIHETTYNSIMKCDVDIR 538 ASSSSLEKSYELPDGQVITIGNERFRCPEA+F PSFLGME+ GIHETTYNSIMKCDVDIR Sbjct: 231 ASSSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIR 290 Query: 537 KDLYANTVLS 508 KDLYANTVLS Sbjct: 291 KDLYANTVLS 300 Score = 111 bits (267), Expect = 5e-25 Identities = 52/55 (94%), Positives = 54/55 (98%) Frame = -1 Query: 508 GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 344 GG+TMYPGIADRMQKEIT+LAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQM Sbjct: 301 GGSTMYPGIADRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 355 Score = 45.6 bits (103), Expect = 4e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -3 Query: 341 ISKQEYDESGPSIVHRKCF 285 ISKQEYDESGPSIVHRKCF Sbjct: 357 ISKQEYDESGPSIVHRKCF 375 >SB_56628| Best HMM Match : Actin (HMM E-Value=0) Length = 376 Score = 143 bits (346), Expect = 1e-34 Identities = 66/70 (94%), Positives = 68/70 (97%) Frame = -2 Query: 717 ASSSSLEKSYELPDGQVITIGNERFRCPEALFHPSFLGMEACGIHETTYNSIMKCDVDIR 538 ASSSSLEKSYELPDGQVITIGNERFRCPEA+F PSFLGME+ GIHETTYNSIMKCDVDIR Sbjct: 232 ASSSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIR 291 Query: 537 KDLYANTVLS 508 KDLYANTVLS Sbjct: 292 KDLYANTVLS 301 Score = 111 bits (266), Expect = 7e-25 Identities = 52/55 (94%), Positives = 54/55 (98%) Frame = -1 Query: 508 GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 344 GG+TMYPGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQM Sbjct: 302 GGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 356 Score = 45.6 bits (103), Expect = 4e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -3 Query: 341 ISKQEYDESGPSIVHRKCF 285 ISKQEYDESGPSIVHRKCF Sbjct: 358 ISKQEYDESGPSIVHRKCF 376 >SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 142 bits (343), Expect = 3e-34 Identities = 65/70 (92%), Positives = 68/70 (97%) Frame = -2 Query: 717 ASSSSLEKSYELPDGQVITIGNERFRCPEALFHPSFLGMEACGIHETTYNSIMKCDVDIR 538 A+SSSLEKSYELPDGQVITIGNERFRCPEA+F PSFLGME+ GIHETTYNSIMKCDVDIR Sbjct: 231 AASSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIR 290 Query: 537 KDLYANTVLS 508 KDLYANTVLS Sbjct: 291 KDLYANTVLS 300 Score = 109 bits (262), Expect = 2e-24 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = -1 Query: 508 GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 344 GG+TM+PGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQM Sbjct: 301 GGSTMFPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 355 Score = 45.6 bits (103), Expect = 4e-05 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -3 Query: 341 ISKQEYDESGPSIVHRKCF 285 ISKQEYDESGPSIVHRKCF Sbjct: 357 ISKQEYDESGPSIVHRKCF 375 >SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 349 Score = 139 bits (337), Expect = 2e-33 Identities = 64/70 (91%), Positives = 67/70 (95%) Frame = -2 Query: 717 ASSSSLEKSYELPDGQVITIGNERFRCPEALFHPSFLGMEACGIHETTYNSIMKCDVDIR 538 ASSSS+EKSYELPDGQVITIGNERFRCPEAL PSFLGME+ GIHETTYNSIMKCDVDIR Sbjct: 205 ASSSSIEKSYELPDGQVITIGNERFRCPEALLQPSFLGMESSGIHETTYNSIMKCDVDIR 264 Query: 537 KDLYANTVLS 508 KDLYANTV+S Sbjct: 265 KDLYANTVMS 274 Score = 113 bits (273), Expect = 1e-25 Identities = 53/55 (96%), Positives = 55/55 (100%) Frame = -1 Query: 508 GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 344 GGTTMYPG+ADRMQKEI+ALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM Sbjct: 275 GGTTMYPGLADRMQKEISALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 329 Score = 44.4 bits (100), Expect = 9e-05 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = -3 Query: 341 ISKQEYDESGPSIVHRKCF 285 ISKQEYDESGP+IVHRKCF Sbjct: 331 ISKQEYDESGPAIVHRKCF 349 >SB_13344| Best HMM Match : Actin (HMM E-Value=1.5e-07) Length = 149 Score = 123 bits (297), Expect = 1e-28 Identities = 56/70 (80%), Positives = 62/70 (88%) Frame = -2 Query: 717 ASSSSLEKSYELPDGQVITIGNERFRCPEALFHPSFLGMEACGIHETTYNSIMKCDVDIR 538 A+S LEK+YELPDGQVI+IGNERFRCPEA+F P+FLGMEA GIHE YN IMKCDVDIR Sbjct: 5 ANSPILEKTYELPDGQVISIGNERFRCPEAMFQPAFLGMEAPGIHEAIYNCIMKCDVDIR 64 Query: 537 KDLYANTVLS 508 KDLY+N VLS Sbjct: 65 KDLYSNCVLS 74 Score = 103 bits (247), Expect = 1e-22 Identities = 48/69 (69%), Positives = 55/69 (79%) Frame = -1 Query: 508 GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM*SRNR 329 GG+TM+PGIADRMQKEI LA ++MK+K+IAPPERKYSVWIGGSILASLSTFQQM Sbjct: 75 GGSTMFPGIADRMQKEIAMLANASMKVKVIAPPERKYSVWIGGSILASLSTFQQMWIAKE 134 Query: 328 STTSLAPPL 302 PP+ Sbjct: 135 EYHEYGPPI 143 Score = 35.9 bits (79), Expect = 0.033 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = -3 Query: 341 ISKQEYDESGPSIVHRKCF 285 I+K+EY E GP IVHRKCF Sbjct: 131 IAKEEYHEYGPPIVHRKCF 149 >SB_54| Best HMM Match : Actin (HMM E-Value=0) Length = 2486 Score = 83.0 bits (196), Expect = 2e-16 Identities = 38/69 (55%), Positives = 47/69 (68%) Frame = -2 Query: 714 SSSSLEKSYELPDGQVITIGNERFRCPEALFHPSFLGMEACGIHETTYNSIMKCDVDIRK 535 +S E Y LPDGQ I IG+ERFR E LF PS LG + GIHE+ + SI KCD+D+R Sbjct: 2277 TSDDCEAPYMLPDGQSIRIGSERFRAAEPLFQPSLLGRDIDGIHESIFKSIKKCDIDLRA 2336 Query: 534 DLYANTVLS 508 +L+ N VLS Sbjct: 2337 ELFHNIVLS 2345 >SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 411 Score = 67.7 bits (158), Expect = 9e-12 Identities = 28/65 (43%), Positives = 40/65 (61%) Frame = -2 Query: 702 LEKSYELPDGQVITIGNERFRCPEALFHPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 523 L + Y LPDG+V+ + ERF PEALF P + +E G+ E +N+I D+D R + Y Sbjct: 240 LVEQYTLPDGRVVKLSGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYK 299 Query: 522 NTVLS 508 + VLS Sbjct: 300 HIVLS 304 Score = 31.1 bits (67), Expect(2) = 3e-04 Identities = 12/24 (50%), Positives = 19/24 (79%) Frame = -1 Query: 433 KIKIIAPPERKYSVWIGGSILASL 362 KI+I PP RK+ V++GG++LA + Sbjct: 358 KIRIEDPPRRKHMVFMGGAVLADI 381 Score = 30.7 bits (66), Expect(2) = 3e-04 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = -1 Query: 508 GGTTMYPGIADRMQKEITAL 449 GG+TMYPG+ R+++EI L Sbjct: 305 GGSTMYPGLPSRLEREIKQL 324 >SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07) Length = 240 Score = 51.6 bits (118), Expect = 6e-07 Identities = 23/61 (37%), Positives = 39/61 (63%), Gaps = 3/61 (4%) Frame = -1 Query: 535 GLVRQHRIVGGTTMYPGIADRMQKEITALAPSTMKIKIIA---PPERKYSVWIGGSILAS 365 GL + GG T+ G +R+ +E+ + P +M++K+I+ E++++ WIGGSILAS Sbjct: 170 GLFNSVIVTGGNTLLQGFVERLNRELVSKTPPSMRLKLISNNSSVEKRFNPWIGGSILAS 229 Query: 364 L 362 L Sbjct: 230 L 230 >SB_26136| Best HMM Match : Actin (HMM E-Value=7.2e-10) Length = 543 Score = 44.4 bits (100), Expect = 9e-05 Identities = 21/54 (38%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = -2 Query: 666 ITIGNERFRCPEALFHPSFLGME-ACGIHETTYNSIMKCDVDIRKDLYANTVLS 508 + + ERF PE FHP F + + E N I C +D+R+ LY N VLS Sbjct: 196 VDVAYERFLGPEIFFHPEFSNPDFTTPLSEVVDNVIQNCPIDVRRPLYKNIVLS 249 Score = 31.9 bits (69), Expect = 0.53 Identities = 12/33 (36%), Positives = 22/33 (66%) Frame = -1 Query: 451 LAPSTMKIKIIAPPERKYSVWIGGSILASLSTF 353 + P ++ ++I+ ++Y+VW GGS+LAS F Sbjct: 285 IKPKPIETQVISHHMQRYAVWFGGSMLASTPEF 317 >SB_49385| Best HMM Match : Actin (HMM E-Value=0.00022) Length = 921 Score = 35.9 bits (79), Expect = 0.033 Identities = 17/36 (47%), Positives = 21/36 (58%) Frame = -2 Query: 714 SSSSLEKSYELPDGQVITIGNERFRCPEALFHPSFL 607 ++ L K Y LPDGQ+I+IG E E LF P L Sbjct: 863 TNEGLTKFYTLPDGQMISIGYECISSMEPLFRPDLL 898 >SB_22343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 33.5 bits (73), Expect = 0.18 Identities = 20/60 (33%), Positives = 29/60 (48%), Gaps = 9/60 (15%) Frame = -1 Query: 514 IVGGTTMYPGIADRMQKEITALAPS--------TMKIKIIAPP-ERKYSVWIGGSILASL 362 ++GGT M PG R+ +EI L S +K+ PP + W+GG+I SL Sbjct: 83 LIGGTAMTPGFKHRLMQEIYLLLQSPKYKDKLFIKTVKMHQPPVNANITAWLGGAIFGSL 142 >SB_38098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 503 Score = 32.3 bits (70), Expect = 0.40 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = -3 Query: 668 SSLSETKDSVAQRLSSTLRSWVWK 597 S+ SE K SV +R + TL++W+W+ Sbjct: 193 STRSELKSSVVERFNRTLKTWIWR 216 >SB_27551| Best HMM Match : rve (HMM E-Value=6.3e-25) Length = 291 Score = 31.5 bits (68), Expect = 0.71 Identities = 14/37 (37%), Positives = 23/37 (62%), Gaps = 2/37 (5%) Frame = -3 Query: 668 SSLSETKDSVAQRLSSTLRSWVWK--LAASTRPHITP 564 S+ SE K SV +R + TL++W+W+ TR ++ P Sbjct: 226 STQSELKASVVERFNRTLKTWMWRWFTHKETRRYVLP 262 >SB_6618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 574 Score = 31.5 bits (68), Expect = 0.71 Identities = 18/41 (43%), Positives = 24/41 (58%) Frame = +2 Query: 263 AATRGAFRSTSCVQWRGQTRRTPVSRSHLLEGREGGEDRST 385 ++TRG RST+ + R +TR + RSH REG RST Sbjct: 259 SSTRGRSRSTATSRGRTRTRTSTRRRSH-TSSREGTRSRST 298 >SB_20812| Best HMM Match : rve (HMM E-Value=1.2e-25) Length = 1097 Score = 31.1 bits (67), Expect = 0.93 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = -3 Query: 668 SSLSETKDSVAQRLSSTLRSWVWK 597 S+ SETK SV +R + T + W+W+ Sbjct: 457 STKSETKASVVERFNRTFKGWMWR 480 >SB_58386| Best HMM Match : rve (HMM E-Value=8.6e-26) Length = 212 Score = 31.1 bits (67), Expect = 0.93 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = -3 Query: 668 SSLSETKDSVAQRLSSTLRSWVWK 597 S+ SETK SV +R + T + W+W+ Sbjct: 93 STKSETKASVVERFNRTFKGWMWR 116 >SB_33253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1383 Score = 31.1 bits (67), Expect = 0.93 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = -3 Query: 668 SSLSETKDSVAQRLSSTLRSWVWK 597 S+ SETK SV +R + T + W+W+ Sbjct: 439 STKSETKASVVERFNRTFKGWMWR 462 >SB_59599| Best HMM Match : rve (HMM E-Value=1.69557e-43) Length = 1803 Score = 30.7 bits (66), Expect = 1.2 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = -3 Query: 668 SSLSETKDSVAQRLSSTLRSWVWK 597 S+ SE K SV +R + TL++W+W+ Sbjct: 628 STRSELKASVVERFNRTLKTWMWR 651 >SB_56732| Best HMM Match : rve (HMM E-Value=0.0016) Length = 236 Score = 30.7 bits (66), Expect = 1.2 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = -3 Query: 668 SSLSETKDSVAQRLSSTLRSWVWK 597 S+ SE K SV +R + TL++W+W+ Sbjct: 54 STRSELKASVVERFNRTLKTWMWR 77 >SB_51082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1529 Score = 30.7 bits (66), Expect = 1.2 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = -3 Query: 668 SSLSETKDSVAQRLSSTLRSWVWK 597 S+ SE K SV +R + TL++W+W+ Sbjct: 232 STRSELKASVVERFNRTLKTWMWR 255 >SB_45111| Best HMM Match : rve (HMM E-Value=1.2e-24) Length = 1575 Score = 30.7 bits (66), Expect = 1.2 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = -3 Query: 668 SSLSETKDSVAQRLSSTLRSWVWK 597 S+ SE K SV +R + TL++W+W+ Sbjct: 1475 STRSELKASVVERFNRTLKTWMWR 1498 >SB_35781| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 459 Score = 30.7 bits (66), Expect = 1.2 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = -3 Query: 668 SSLSETKDSVAQRLSSTLRSWVWK 597 S+ SE K SV +R + TL++W+W+ Sbjct: 91 STRSELKASVVERFNRTLKTWMWR 114 >SB_34804| Best HMM Match : rve (HMM E-Value=1.2e-24) Length = 1725 Score = 30.7 bits (66), Expect = 1.2 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = -3 Query: 668 SSLSETKDSVAQRLSSTLRSWVWK 597 S+ SE K SV +R + TL++W+W+ Sbjct: 485 STRSELKASVVERFNRTLKTWMWR 508 >SB_30663| Best HMM Match : rve (HMM E-Value=3.3e-25) Length = 346 Score = 30.7 bits (66), Expect = 1.2 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = -3 Query: 668 SSLSETKDSVAQRLSSTLRSWVWK 597 S+ SE K SV +R + TL++W+W+ Sbjct: 285 STRSELKASVVERFNRTLKTWMWR 308 >SB_20671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 249 Score = 30.7 bits (66), Expect = 1.2 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = -3 Query: 668 SSLSETKDSVAQRLSSTLRSWVWK 597 S+ SE K SV +R + TL++W+W+ Sbjct: 182 STRSELKASVVERFNRTLKTWMWR 205 >SB_16139| Best HMM Match : rve (HMM E-Value=3.6e-21) Length = 889 Score = 30.7 bits (66), Expect = 1.2 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = -3 Query: 668 SSLSETKDSVAQRLSSTLRSWVWK 597 S+ SE K SV +R + TL++W+W+ Sbjct: 430 STRSELKASVVERFNRTLKTWMWR 453 >SB_11605| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 794 Score = 30.7 bits (66), Expect = 1.2 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = -3 Query: 668 SSLSETKDSVAQRLSSTLRSWVWK 597 S+ SE K SV +R + TL++W+W+ Sbjct: 171 STRSELKASVVERFNRTLKTWMWR 194 >SB_7864| Best HMM Match : rve (HMM E-Value=2.9e-23) Length = 346 Score = 30.7 bits (66), Expect = 1.2 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = -3 Query: 668 SSLSETKDSVAQRLSSTLRSWVWK 597 S+ SE K SV +R + TL++W+W+ Sbjct: 206 STRSELKASVVERFNRTLKTWMWR 229 >SB_42815| Best HMM Match : rve (HMM E-Value=0.00022) Length = 1514 Score = 30.7 bits (66), Expect = 1.2 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = -3 Query: 668 SSLSETKDSVAQRLSSTLRSWVWK 597 S+ SE K SV +R + TL++W+W+ Sbjct: 59 STQSELKASVVERFNRTLKTWMWR 82 >SB_41315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1761 Score = 30.7 bits (66), Expect = 1.2 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = -3 Query: 668 SSLSETKDSVAQRLSSTLRSWVWK 597 S+ SE K SV +R + TL++W+W+ Sbjct: 176 STRSELKASVVERFNRTLKTWMWR 199 >SB_39511| Best HMM Match : rve (HMM E-Value=0.0016) Length = 850 Score = 30.7 bits (66), Expect = 1.2 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = -3 Query: 668 SSLSETKDSVAQRLSSTLRSWVWK 597 S+ SE K SV +R + TL++W+W+ Sbjct: 54 STRSELKASVVERFNRTLKTWMWR 77 >SB_31260| Best HMM Match : rve (HMM E-Value=5.2e-25) Length = 1962 Score = 30.7 bits (66), Expect = 1.2 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = -3 Query: 668 SSLSETKDSVAQRLSSTLRSWVWK 597 S+ SE K SV +R + TL++W+W+ Sbjct: 724 STRSELKASVVERFNRTLKTWMWR 747 >SB_2799| Best HMM Match : rve (HMM E-Value=7.8e-26) Length = 1058 Score = 30.7 bits (66), Expect = 1.2 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = -3 Query: 668 SSLSETKDSVAQRLSSTLRSWVWK 597 S+ SE K SV +R + TL++W+W+ Sbjct: 238 STRSELKASVVERFNRTLKTWMWR 261 >SB_22949| Best HMM Match : rve (HMM E-Value=1.2e-19) Length = 158 Score = 30.3 bits (65), Expect = 1.6 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = -3 Query: 668 SSLSETKDSVAQRLSSTLRSWVWK 597 S+ SETK SV +R + T + W+W+ Sbjct: 96 STKSETKASVVERFNRTSKEWMWR 119 >SB_11501| Best HMM Match : rve (HMM E-Value=3.8e-11) Length = 357 Score = 30.3 bits (65), Expect = 1.6 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = -3 Query: 668 SSLSETKDSVAQRLSSTLRSWVWK 597 S+ SE K SV +R + TL++W+W+ Sbjct: 212 STRSEFKASVVERFNRTLKTWMWR 235 >SB_39041| Best HMM Match : rve (HMM E-Value=2.3e-10) Length = 1164 Score = 29.9 bits (64), Expect = 2.2 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = -3 Query: 668 SSLSETKDSVAQRLSSTLRSWVWK 597 S+ +ETK SV +R + T + W+W+ Sbjct: 100 STKNETKASVVERFNRTFKGWMWR 123 >SB_30721| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 40 Score = 29.9 bits (64), Expect = 2.2 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -2 Query: 636 PEALFHPSFLGMEACGIHET 577 PE +F PS LG+E GI ET Sbjct: 3 PEIIFQPSMLGLEQAGITET 22 >SB_28997| Best HMM Match : rve (HMM E-Value=2.3e-10) Length = 1847 Score = 29.9 bits (64), Expect = 2.2 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = -3 Query: 668 SSLSETKDSVAQRLSSTLRSWVWK 597 S+ +ETK SV +R + T + W+W+ Sbjct: 902 STKNETKASVVERFNRTFKGWMWR 925 >SB_41148| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 583 Score = 29.5 bits (63), Expect = 2.8 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = -1 Query: 331 RSTTSLAPPLYTGSASKRTARRCLQHPRPAAQFRL 227 ++T P++T S K+T R C++ P P + R+ Sbjct: 18 KNTLRFIMPVFTRSGRKKTNRTCIEDPTPQTERRV 52 >SB_1624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 427 Score = 29.5 bits (63), Expect = 2.8 Identities = 12/22 (54%), Positives = 17/22 (77%) Frame = +1 Query: 148 RPALRPAVTITLITIISYVQLN 213 RP + PA T TLIT+I YV+++ Sbjct: 125 RPLMTPAKTGTLITVIDYVEID 146 >SB_48528| Best HMM Match : Extensin_2 (HMM E-Value=1) Length = 329 Score = 29.1 bits (62), Expect = 3.8 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -1 Query: 706 LPREVLRTSRRSGHHYRKRKIPLPRGSLP 620 LPR ++R HY++ +PLPRG P Sbjct: 132 LPRGGSPLTKRRESHYQEEGVPLPRGGSP 160 Score = 28.3 bits (60), Expect = 6.6 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -1 Query: 706 LPREVLRTSRRSGHHYRKRKIPLPRGSLP 620 LPR ++R HY++ +PLPRG P Sbjct: 154 LPRGGSPLTKRRESHYQEEGVPLPRGGGP 182 >SB_39712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 230 Score = 29.1 bits (62), Expect = 3.8 Identities = 27/111 (24%), Positives = 45/111 (40%) Frame = +2 Query: 263 AATRGAFRSTSCVQWRGQTRRTPVSRSHLLEGREGGEDRSTDPYGVLPLWRSNDLNLHCR 442 A+T F T R +R PV +++ L G + GV W S+DL+ + Sbjct: 107 ASTGMTFNQTKSKVMRVSRKRKPVLKTYSLGGLPLACTETEKDLGV---WMSDDLSWTKQ 163 Query: 443 WGESCDFLLHTVGDSRVHGGTTDNTVLAYKSLRMSTSHFMMELYVVSWMPQ 595 E+C T+G R H + T + +S+ ++ + W PQ Sbjct: 164 VDEACSKANRTLGFVRRHSRSIKKTNIR-RSMYLALVRPHLGYATQLWAPQ 213 >SB_35875| Best HMM Match : RVT_1 (HMM E-Value=5.2e-24) Length = 1423 Score = 29.1 bits (62), Expect = 3.8 Identities = 27/111 (24%), Positives = 45/111 (40%) Frame = +2 Query: 263 AATRGAFRSTSCVQWRGQTRRTPVSRSHLLEGREGGEDRSTDPYGVLPLWRSNDLNLHCR 442 A+T F T R +R PV +++ L G + GV W S+DL+ + Sbjct: 1140 ASTGMTFNQTKSKVMRVSRKRKPVLKTYSLGGLPLACTETEKDLGV---WMSDDLSWTKQ 1196 Query: 443 WGESCDFLLHTVGDSRVHGGTTDNTVLAYKSLRMSTSHFMMELYVVSWMPQ 595 E+C T+G R H + T + +S+ ++ + W PQ Sbjct: 1197 VDEACSKANRTLGFVRRHSRSIKKTNIR-RSMYLALVRPHLGYATQLWAPQ 1246 >SB_149| Best HMM Match : rve (HMM E-Value=6.3e-20) Length = 2232 Score = 29.1 bits (62), Expect = 3.8 Identities = 9/21 (42%), Positives = 16/21 (76%) Frame = -3 Query: 659 SETKDSVAQRLSSTLRSWVWK 597 SE K S+ +R + TL++W+W+ Sbjct: 1503 SEMKASIVERFNRTLKTWMWR 1523 >SB_37044| Best HMM Match : rve (HMM E-Value=4.1e-07) Length = 1033 Score = 29.1 bits (62), Expect = 3.8 Identities = 9/21 (42%), Positives = 16/21 (76%) Frame = -3 Query: 659 SETKDSVAQRLSSTLRSWVWK 597 SE K S+ +R + TL++W+W+ Sbjct: 84 SEMKASIVERFNRTLKTWMWR 104 >SB_20293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1821 Score = 29.1 bits (62), Expect = 3.8 Identities = 27/111 (24%), Positives = 45/111 (40%) Frame = +2 Query: 263 AATRGAFRSTSCVQWRGQTRRTPVSRSHLLEGREGGEDRSTDPYGVLPLWRSNDLNLHCR 442 A+T F T R +R PV +++ L G + GV W S+DL+ + Sbjct: 629 ASTGMTFNQTKSKVMRVSRKRKPVLKTYSLGGLPLACTETEKDLGV---WMSDDLSWTKQ 685 Query: 443 WGESCDFLLHTVGDSRVHGGTTDNTVLAYKSLRMSTSHFMMELYVVSWMPQ 595 E+C T+G R H + T + +S+ ++ + W PQ Sbjct: 686 VDEACSKANRTLGFVRRHSRSIKKTNIR-RSMYLALVRPHLGYATQLWAPQ 735 >SB_9849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 984 Score = 29.1 bits (62), Expect = 3.8 Identities = 27/111 (24%), Positives = 45/111 (40%) Frame = +2 Query: 263 AATRGAFRSTSCVQWRGQTRRTPVSRSHLLEGREGGEDRSTDPYGVLPLWRSNDLNLHCR 442 A+T F T R +R PV +++ L G + GV W S+DL+ + Sbjct: 861 ASTGMTFNQTKSKVMRVSRKRKPVLKTYSLGGLPLACTETEKDLGV---WMSDDLSWTKQ 917 Query: 443 WGESCDFLLHTVGDSRVHGGTTDNTVLAYKSLRMSTSHFMMELYVVSWMPQ 595 E+C T+G R H + T + +S+ ++ + W PQ Sbjct: 918 VDEACSKANRTLGFVRRHSRSIKKTNIR-RSMYLALVRPHLGYATQLWAPQ 967 >SB_2550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 929 Score = 29.1 bits (62), Expect = 3.8 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = -3 Query: 668 SSLSETKDSVAQRLSSTLRSWVWK 597 S+ SE + SV +R + TL++W+W+ Sbjct: 220 STRSELEASVVERFNRTLKTWMWR 243 >SB_25899| Best HMM Match : Ribonuc_2-5A (HMM E-Value=0) Length = 603 Score = 28.7 bits (61), Expect = 5.0 Identities = 15/42 (35%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = -1 Query: 700 REVLRTSRRSGHHYRKRKIPLPR--GSLPPFVLGYGSLRHPR 581 R++LR R HHYR+ + R G++P + Y + R PR Sbjct: 521 RDLLRALRNKKHHYRELPDEVKRSLGTIPDEYVRYFTSRFPR 562 >SB_46270| Best HMM Match : rve (HMM E-Value=1.2e-09) Length = 657 Score = 28.7 bits (61), Expect = 5.0 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = -3 Query: 668 SSLSETKDSVAQRLSSTLRSWVWK 597 S+ SE SV +R + TL++W+W+ Sbjct: 218 STRSELNASVVERFNRTLKTWMWR 241 >SB_15486| Best HMM Match : rve (HMM E-Value=1.2e-09) Length = 662 Score = 28.7 bits (61), Expect = 5.0 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = -3 Query: 668 SSLSETKDSVAQRLSSTLRSWVWK 597 S+ SE SV +R + TL++W+W+ Sbjct: 218 STRSELNASVVERFNRTLKTWMWR 241 >SB_28024| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 968 Score = 28.3 bits (60), Expect = 6.6 Identities = 23/85 (27%), Positives = 35/85 (41%) Frame = +2 Query: 263 AATRGAFRSTSCVQWRGQTRRTPVSRSHLLEGREGGEDRSTDPYGVLPLWRSNDLNLHCR 442 A+T F T R +R PV +++ L G + GV W S+DL+ + Sbjct: 726 ASTGMTFNQTKSKVMRVSRKRKPVLKTYSLGGLPLACTETEKDLGV---WMSDDLSWTKQ 782 Query: 443 WGESCDFLLHTVGDSRVHGGTTDNT 517 E+C T+G R H + T Sbjct: 783 VDEACSKANRTLGFVRRHSRSIKKT 807 >SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 795 Score = 27.9 bits (59), Expect = 8.7 Identities = 16/47 (34%), Positives = 22/47 (46%) Frame = -3 Query: 368 LPLYLPTDVISKQEYDESGPSIVHRKCF*THRASLPPAPAAGCSIQA 228 LPL P + +S DES PS H +S PP P+ S+ + Sbjct: 721 LPLPPPPEEVSLPPPDESPPSSKHPPTVSPSSSSAPPRPSTPPSVSS 767 >SB_37543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 27.9 bits (59), Expect = 8.7 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -3 Query: 668 SSLSETKDSVAQRLSSTLRSWVWK 597 S+ SE K SV + TL++WVW+ Sbjct: 219 STRSELKASVVEPFIRTLKTWVWR 242 >SB_20960| Best HMM Match : Neuralized (HMM E-Value=3.9) Length = 252 Score = 27.9 bits (59), Expect = 8.7 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = -3 Query: 656 ETKDSVAQRLSSTLRSWVWK 597 E K SV +R + TL++W+W+ Sbjct: 2 ELKASVVERFNRTLKTWMWR 21 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,057,115 Number of Sequences: 59808 Number of extensions: 559998 Number of successful extensions: 1740 Number of sequences better than 10.0: 57 Number of HSP's better than 10.0 without gapping: 1553 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1725 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1901817086 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -