BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021165 (654 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0510 + 19846834-19848100,19848114-19848391 35 0.065 12_02_0506 - 19794383-19794670,19795066-19795140,19795337-197987... 35 0.065 07_01_0069 + 505291-505327,505726-505956,506317-506652,507025-50... 28 7.5 03_06_0489 - 34284301-34284336,34285104-34285227,34285307-342853... 28 7.5 >12_02_0510 + 19846834-19848100,19848114-19848391 Length = 514 Score = 34.7 bits (76), Expect = 0.065 Identities = 16/46 (34%), Positives = 27/46 (58%) Frame = -1 Query: 321 IFFLIKESLERRPMENYKKKTKAERKCVKKSDIRYFLILYRITENQ 184 I +++ ++L+R P+EN KTK + K K + Y + L I +NQ Sbjct: 26 ISYVVNKALDRLPLENEDLKTKLKSKLSKTQAMLYGITLQEIQDNQ 71 >12_02_0506 - 19794383-19794670,19795066-19795140,19795337-19798704, 19799503-19799671,19799758-19799850 Length = 1330 Score = 34.7 bits (76), Expect = 0.065 Identities = 16/46 (34%), Positives = 27/46 (58%) Frame = -1 Query: 321 IFFLIKESLERRPMENYKKKTKAERKCVKKSDIRYFLILYRITENQ 184 I +++ ++L+R P+EN KTK + K K + Y + L I +NQ Sbjct: 117 ISYVVNKALDRLPLENEDLKTKLKSKLSKTQAMLYGITLQEIQDNQ 162 >07_01_0069 + 505291-505327,505726-505956,506317-506652,507025-507372, 507735-508594,508902-508971,509157-509371,509477-509537, 509606-509715,510644-510694,510794-510916 Length = 813 Score = 27.9 bits (59), Expect = 7.5 Identities = 12/44 (27%), Positives = 25/44 (56%) Frame = -1 Query: 351 KDEKDNNSVYIFFLIKESLERRPMENYKKKTKAERKCVKKSDIR 220 K KDNNS L + S+ER+ +N ++ + + ++S+++ Sbjct: 399 KGNKDNNSQLCSSLHESSIERKRRKNRDRRRRKKENANRRSNVQ 442 >03_06_0489 - 34284301-34284336,34285104-34285227,34285307-34285371, 34285472-34285555,34285661-34285789,34285887-34285976, 34286116-34286250,34286939-34286984,34287119-34287225, 34287355-34287412,34287524-34287765 Length = 371 Score = 27.9 bits (59), Expect = 7.5 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = +1 Query: 109 FCFENVRKIDTTHSLQLTQ 165 F FE++RKI THSL+ T+ Sbjct: 68 FFFEHIRKIGCTHSLERTE 86 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,610,583 Number of Sequences: 37544 Number of extensions: 246713 Number of successful extensions: 469 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 461 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 468 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1632177336 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -