BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021165 (654 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. 25 2.1 CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 24 3.7 >AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. Length = 615 Score = 25.0 bits (52), Expect = 2.1 Identities = 13/39 (33%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = -3 Query: 118 QNKIDISSI*QRQHRAGSSRSTAVS--YAKPEIDRENRH 8 Q K+ + + +++ R TA YAK D+ENRH Sbjct: 464 QRKLLLGQMVEKEVRERREADTAAELRYAKEHADKENRH 502 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 24.2 bits (50), Expect = 3.7 Identities = 11/33 (33%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Frame = -1 Query: 114 TKSISHLFSNGNTEPVARGL-PQCRTLSRRSTV 19 T + +H+ +NG+ PV+ G PQ ++R+T+ Sbjct: 1216 TSNEAHVIANGHDGPVSAGKPPQAPPKAKRTTL 1248 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 607,945 Number of Sequences: 2352 Number of extensions: 11030 Number of successful extensions: 44 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 44 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 44 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64814025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -