BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021165 (654 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g24140.1 68416.m03031 basic helix-loop-helix (bHLH) family pr... 31 0.88 At3g47720.1 68416.m05199 expressed protein 29 3.6 At2g42270.1 68415.m05232 U5 small nuclear ribonucleoprotein heli... 28 6.2 At3g55630.3 68416.m06181 dihydrofolate synthetase/folylpolygluta... 27 8.2 At3g55630.2 68416.m06180 dihydrofolate synthetase/folylpolygluta... 27 8.2 At3g55630.1 68416.m06179 dihydrofolate synthetase/folylpolygluta... 27 8.2 >At3g24140.1 68416.m03031 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 Helix-loop-helix DNA-binding domain Length = 414 Score = 30.7 bits (66), Expect = 0.88 Identities = 18/51 (35%), Positives = 26/51 (50%) Frame = -1 Query: 381 NVNLSNTGLLKDEKDNNSVYIFFLIKESLERRPMENYKKKTKAERKCVKKS 229 NV L D+ DNNSV + F+ E +R KK+ K++RK + S Sbjct: 136 NVFLEEKEDQDDDNDNNSVQLRFIGGEEEDRENKNVTKKEVKSKRKRARTS 186 >At3g47720.1 68416.m05199 expressed protein Length = 316 Score = 28.7 bits (61), Expect = 3.6 Identities = 15/48 (31%), Positives = 26/48 (54%) Frame = -3 Query: 535 KSEETLIRQIKQNTQLHTSRSRQKVLWNCYL*HTLTGNFFNFSPI*KD 392 K+EET I + + +T SRS +++ +C H+ N F + + KD Sbjct: 5 KTEETPINEEQGSTNSSESRSNEELFSDCDQQHSSIANEFGLTELPKD 52 >At2g42270.1 68415.m05232 U5 small nuclear ribonucleoprotein helicase, putative Length = 2172 Score = 27.9 bits (59), Expect = 6.2 Identities = 12/39 (30%), Positives = 23/39 (58%) Frame = -3 Query: 568 KQLINHRYYTFKSEETLIRQIKQNTQLHTSRSRQKVLWN 452 ++LINH+ ++F++ ++K + L SRQK+ N Sbjct: 1897 RRLINHQRFSFQNPRCTDPRVKTSALLQAHFSRQKISGN 1935 >At3g55630.3 68416.m06181 dihydrofolate synthetase/folylpolyglutamate synthetase (DHFS/FPGS4) nearly identical to folylpolyglutamate-dihydrofolate synthetase [Arabidopsis thaliana] GI:17976761 Length = 492 Score = 27.5 bits (58), Expect = 8.2 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = -3 Query: 514 RQIKQNTQLHTSRSRQKVLWNC 449 +QIKQN + + RS Q +L+NC Sbjct: 340 KQIKQNQERNQKRSEQILLFNC 361 >At3g55630.2 68416.m06180 dihydrofolate synthetase/folylpolyglutamate synthetase (DHFS/FPGS4) nearly identical to folylpolyglutamate-dihydrofolate synthetase [Arabidopsis thaliana] GI:17976761 Length = 491 Score = 27.5 bits (58), Expect = 8.2 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = -3 Query: 514 RQIKQNTQLHTSRSRQKVLWNC 449 +QIKQN + + RS Q +L+NC Sbjct: 339 KQIKQNQERNQKRSEQILLFNC 360 >At3g55630.1 68416.m06179 dihydrofolate synthetase/folylpolyglutamate synthetase (DHFS/FPGS4) nearly identical to folylpolyglutamate-dihydrofolate synthetase [Arabidopsis thaliana] GI:17976761 Length = 470 Score = 27.5 bits (58), Expect = 8.2 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = -3 Query: 514 RQIKQNTQLHTSRSRQKVLWNC 449 +QIKQN + + RS Q +L+NC Sbjct: 318 KQIKQNQERNQKRSEQILLFNC 339 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,494,774 Number of Sequences: 28952 Number of extensions: 226203 Number of successful extensions: 499 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 491 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 499 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1363910256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -