BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021163 (710 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_20899| Best HMM Match : RRM_1 (HMM E-Value=2.3e-15) 46 3e-05 SB_11682| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_51896| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_41412| Best HMM Match : RRM_1 (HMM E-Value=2.9e-35) 42 5e-04 SB_37500| Best HMM Match : RRM_1 (HMM E-Value=7.3e-38) 42 5e-04 SB_53534| Best HMM Match : RRM_1 (HMM E-Value=1e-18) 41 9e-04 SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) 40 0.002 SB_11683| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_59562| Best HMM Match : RRM_1 (HMM E-Value=6.1e-23) 37 0.014 SB_57661| Best HMM Match : RRM_1 (HMM E-Value=0.017) 37 0.019 SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_27480| Best HMM Match : RRM_1 (HMM E-Value=3.7e-18) 36 0.032 SB_2543| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.032 SB_27005| Best HMM Match : NTF2 (HMM E-Value=1.1e-33) 35 0.057 SB_8450| Best HMM Match : RRM_1 (HMM E-Value=1.7e-36) 35 0.057 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 35 0.057 SB_971| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.075 SB_33046| Best HMM Match : RRM_1 (HMM E-Value=3.6e-13) 35 0.075 SB_28070| Best HMM Match : RRM_1 (HMM E-Value=1.3e-07) 35 0.075 SB_2700| Best HMM Match : RRM_1 (HMM E-Value=0) 35 0.075 SB_57433| Best HMM Match : RRM_1 (HMM E-Value=4.5e-24) 34 0.099 SB_52333| Best HMM Match : RRM_1 (HMM E-Value=2.3e-16) 34 0.099 SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.099 SB_47831| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.099 SB_11106| Best HMM Match : RRM_1 (HMM E-Value=1.8e-11) 34 0.099 SB_1873| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_37749| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_34757| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_37198| Best HMM Match : RRM_1 (HMM E-Value=7.8e-23) 32 0.40 SB_33676| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.40 SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.40 SB_8823| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.40 SB_6474| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.53 SB_3033| Best HMM Match : RRM_1 (HMM E-Value=2.3e-20) 31 0.70 SB_50249| Best HMM Match : RRM_1 (HMM E-Value=0) 31 0.70 SB_45423| Best HMM Match : RRM_1 (HMM E-Value=0) 31 0.70 SB_53070| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_44114| Best HMM Match : RRM_1 (HMM E-Value=9.9e-35) 31 0.92 SB_9401| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_39433| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_39475| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_18756| Best HMM Match : Sterol_desat (HMM E-Value=0) 30 1.6 SB_463| Best HMM Match : RRM_1 (HMM E-Value=3.3e-16) 30 1.6 SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_28139| Best HMM Match : RRM_1 (HMM E-Value=3.7e-28) 30 2.1 SB_3536| Best HMM Match : RRM_1 (HMM E-Value=0) 30 2.1 SB_50664| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_47771| Best HMM Match : Annexin (HMM E-Value=0) 29 3.7 SB_46599| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_28089| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_15297| Best HMM Match : RRM_1 (HMM E-Value=2.2e-18) 29 4.9 SB_43251| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_41255| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_40368| Best HMM Match : SASP_gamma (HMM E-Value=2.3) 29 4.9 SB_19711| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) 28 6.5 SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_42891| Best HMM Match : DUF537 (HMM E-Value=1.2e-23) 28 6.5 SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33) 28 8.6 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 28 8.6 SB_34189| Best HMM Match : MAM (HMM E-Value=5.60519e-45) 28 8.6 SB_48623| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_9866| Best HMM Match : TP2 (HMM E-Value=0.27) 28 8.6 >SB_20899| Best HMM Match : RRM_1 (HMM E-Value=2.3e-15) Length = 876 Score = 46.0 bits (104), Expect = 3e-05 Identities = 21/47 (44%), Positives = 30/47 (63%), Gaps = 1/47 (2%) Frame = +1 Query: 121 KIFIGNLS-DKTTEADLRPLFEKYGTVVECDIVRNYGFVHMENEQVA 258 +IFIGNL+ DK DL +F ++G V+ C + N+GFV E E+ A Sbjct: 47 RIFIGNLATDKIARQDLEEIFSRHGKVLGCSLHANFGFVQFETEKGA 93 Score = 44.8 bits (101), Expect = 7e-05 Identities = 19/61 (31%), Positives = 35/61 (57%), Gaps = 1/61 (1%) Frame = +2 Query: 326 SRKAPSTPTTKIFVGNL-TDKTRAPEVRELFQKFGTVVECDIVRNYGFVHLDATGDVNDA 502 ++ P + +IF+GNL TDK ++ E+F + G V+ C + N+GFV + ++A Sbjct: 37 NKNDPHSVRCRIFIGNLATDKIARQDLEEIFSRHGKVLGCSLHANFGFVQFETEKGADEA 96 Query: 503 I 505 + Sbjct: 97 V 97 >SB_11682| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 45.2 bits (102), Expect = 5e-05 Identities = 24/70 (34%), Positives = 35/70 (50%) Frame = +1 Query: 493 ERRYQKLNGMMVDGQPMKVQLSTSRVRQRPGMGDPEQCYRCGRGGPLVQRSARSAGPRPQ 672 E ++L+G + GQ ++V+L+ R RP MG E+CY CGR G + R + Sbjct: 82 EDAVRELDGRYICGQRVRVELAKGPSRGRPRMGSNEKCYECGRVGHFARDCTRRRYGGGR 141 Query: 673 RFPRSSVRPR 702 F S R R Sbjct: 142 SFSNSPKRER 151 Score = 31.1 bits (67), Expect = 0.92 Identities = 15/55 (27%), Positives = 27/55 (49%), Gaps = 3/55 (5%) Frame = +2 Query: 353 TKIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRN---YGFVHLDATGDVNDAIK 508 TK+++G+L D E+ F +G + + + RN + F D D DA++ Sbjct: 32 TKVYIGSLGDNASKREIENEFGYYGPLKDVWVARNPPGFAFCIFDDRRDAEDAVR 86 >SB_51896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 42.3 bits (95), Expect = 4e-04 Identities = 15/52 (28%), Positives = 32/52 (61%) Frame = +2 Query: 353 TKIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRNYGFVHLDATGDVNDAIK 508 T++FVG L+ +T+ ++ +F +G ++ CD+ YGF+ + D +A++ Sbjct: 6 TQLFVGRLSKETKLRDLENVFYLYGKLLRCDLKTAYGFIEYEDPRDAEEAMR 57 Score = 41.9 bits (94), Expect = 5e-04 Identities = 20/53 (37%), Positives = 31/53 (58%) Frame = +1 Query: 100 MPGTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRNYGFVHMENEQVA 258 M GT ++F+G LS +T DL +F YG ++ CD+ YGF+ E+ + A Sbjct: 1 MASRGT-QLFVGRLSKETKLRDLENVFYLYGKLLRCDLKTAYGFIEYEDPRDA 52 >SB_41412| Best HMM Match : RRM_1 (HMM E-Value=2.9e-35) Length = 1118 Score = 41.9 bits (94), Expect = 5e-04 Identities = 17/46 (36%), Positives = 29/46 (63%) Frame = +1 Query: 121 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRNYGFVHMENEQVA 258 ++++G L TTE D+R F YG + + ++ NYGFV E+++ A Sbjct: 4 RVYLGRLPYGTTEDDVRRFFRSYGRLRDINLKNNYGFVEFEDDRDA 49 Score = 39.1 bits (87), Expect = 0.003 Identities = 15/50 (30%), Positives = 29/50 (58%) Frame = +2 Query: 356 KIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRNYGFVHLDATGDVNDAI 505 ++++G L T +VR F+ +G + + ++ NYGFV + D +DA+ Sbjct: 4 RVYLGRLPYGTTEDDVRRFFRSYGRLRDINLKNNYGFVEFEDDRDADDAV 53 >SB_37500| Best HMM Match : RRM_1 (HMM E-Value=7.3e-38) Length = 496 Score = 41.9 bits (94), Expect = 5e-04 Identities = 21/67 (31%), Positives = 38/67 (56%), Gaps = 6/67 (8%) Frame = +2 Query: 326 SRKAPSTPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIV------RNYGFVHLDATG 487 S+ + S KIF+G L T +++ F ++GT+V+C I+ R +GFV +++ Sbjct: 41 SKMSESEKLRKIFIGGLNWNTTEEGLKDYFSQWGTIVDCVIMKRDGRSRGFGFVTYESSD 100 Query: 488 DVNDAIK 508 VN+ +K Sbjct: 101 SVNEVLK 107 Score = 39.9 bits (89), Expect = 0.002 Identities = 21/48 (43%), Positives = 30/48 (62%), Gaps = 6/48 (12%) Frame = +1 Query: 121 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIV------RNYGFVHMEN 246 KIFIG L+ TTE L+ F ++GT+V+C I+ R +GFV E+ Sbjct: 51 KIFIGGLNWNTTEEGLKDYFSQWGTIVDCVIMKRDGRSRGFGFVTYES 98 >SB_53534| Best HMM Match : RRM_1 (HMM E-Value=1e-18) Length = 268 Score = 41.1 bits (92), Expect = 9e-04 Identities = 21/53 (39%), Positives = 33/53 (62%), Gaps = 7/53 (13%) Frame = +1 Query: 121 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN-------YGFVHMENEQVA 258 +IF+ + +TTE++LR FE+YG V E IVR+ Y F+ E+++VA Sbjct: 9 RIFVKGFNRETTESELRAFFEEYGVVKESKIVRDKHGVSKGYAFITFESQEVA 61 Score = 29.1 bits (62), Expect = 3.7 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +2 Query: 356 KIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRN 457 +IFV +T E+R F+++G V E IVR+ Sbjct: 9 RIFVKGFNRETTESELRAFFEEYGVVKESKIVRD 42 >SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) Length = 1531 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/42 (42%), Positives = 26/42 (61%) Frame = +1 Query: 103 PGTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRNYG 228 PG T +F+GN+ TT DL+ FE+YG V++ DI + G Sbjct: 245 PGC-TRTLFVGNIEKTTTYGDLKEAFERYGEVIDVDIKKQPG 285 Score = 33.9 bits (74), Expect = 0.13 Identities = 13/38 (34%), Positives = 24/38 (63%) Frame = +2 Query: 350 TTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRNYG 463 T +FVGN+ T +++E F+++G V++ DI + G Sbjct: 248 TRTLFVGNIEKTTTYGDLKEAFERYGEVIDVDIKKQPG 285 >SB_11683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 39.9 bits (89), Expect = 0.002 Identities = 24/72 (33%), Positives = 34/72 (47%), Gaps = 1/72 (1%) Frame = +1 Query: 493 ERRYQKLNGMMVDGQPMKVQLSTSRVRQRPGMGDPEQCYRCGRGGPLVQR-SARSAGPRP 669 E ++L+G + GQ +V+L+ R RP E+CY CGR G + + R G Sbjct: 52 EDAVRELDGRYICGQRARVELAKGPSRGRPRQASNEKCYECGRVGHFARDCTRRRYGGGR 111 Query: 670 QRFPRSSVRPRS 705 PR R RS Sbjct: 112 SPSPRGRRRSRS 123 >SB_59562| Best HMM Match : RRM_1 (HMM E-Value=6.1e-23) Length = 201 Score = 37.1 bits (82), Expect = 0.014 Identities = 18/56 (32%), Positives = 31/56 (55%), Gaps = 3/56 (5%) Frame = +2 Query: 350 TTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRN---YGFVHLDATGDVNDAIK 508 TTK++VGNL + E+ F+KFG + + + RN + FV + D +A++ Sbjct: 3 TTKLYVGNLGRNADSSELERAFEKFGRLSKVWVARNPPGFAFVEYEDYRDAEEAVR 58 Score = 33.1 bits (72), Expect = 0.23 Identities = 16/46 (34%), Positives = 26/46 (56%), Gaps = 1/46 (2%) Frame = +1 Query: 115 TFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN-YGFVHMENE 249 T K+++GNL ++L FEK+G + + + RN GF +E E Sbjct: 3 TTKLYVGNLGRNADSSELERAFEKFGRLSKVWVARNPPGFAFVEYE 48 >SB_57661| Best HMM Match : RRM_1 (HMM E-Value=0.017) Length = 255 Score = 36.7 bits (81), Expect = 0.019 Identities = 16/50 (32%), Positives = 30/50 (60%), Gaps = 1/50 (2%) Frame = +1 Query: 109 TGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN-YGFVHMENEQV 255 + + K+F+G + E DLRP+FE YG + E I+++ Y H ++ ++ Sbjct: 167 SNSVKLFVGQVPRTWEEKDLRPIFEPYGQIYELTILKDKYTGQHKDDRKL 216 Score = 36.3 bits (80), Expect = 0.025 Identities = 14/34 (41%), Positives = 22/34 (64%) Frame = +1 Query: 121 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN 222 K+F+G +S E DLR +F +GT+ E ++RN Sbjct: 215 KLFVGMISKHAKEEDLRVMFSPFGTIEELTVLRN 248 Score = 32.7 bits (71), Expect = 0.30 Identities = 12/34 (35%), Positives = 22/34 (64%) Frame = +2 Query: 356 KIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRN 457 K+FVG ++ + ++R +F FGT+ E ++RN Sbjct: 215 KLFVGMISKHAKEEDLRVMFSPFGTIEELTVLRN 248 >SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 618 Score = 36.7 bits (81), Expect = 0.019 Identities = 17/41 (41%), Positives = 26/41 (63%) Frame = +1 Query: 109 TGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRNYGF 231 TG ++F+GNL D E +++ +F+KYG V E I + GF Sbjct: 50 TGRCRLFVGNLID-CDEEEMKEMFKKYGEVAEVFINKEKGF 89 Score = 35.9 bits (79), Expect = 0.032 Identities = 19/47 (40%), Positives = 29/47 (61%), Gaps = 2/47 (4%) Frame = +2 Query: 344 TPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDI--VRNYGFVHLD 478 T ++FVGNL D E++E+F+K+G V E I + +GF+ LD Sbjct: 50 TGRCRLFVGNLIDCDEE-EMKEMFKKYGEVAEVFINKEKGFGFIRLD 95 >SB_27480| Best HMM Match : RRM_1 (HMM E-Value=3.7e-18) Length = 209 Score = 35.9 bits (79), Expect = 0.032 Identities = 11/33 (33%), Positives = 24/33 (72%) Frame = +1 Query: 124 IFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN 222 +F+ L+ TT+ DL +F ++GT++ C+++R+ Sbjct: 122 LFVCKLNPVTTDEDLEIIFSRFGTILSCEVIRD 154 Score = 31.9 bits (69), Expect = 0.53 Identities = 11/37 (29%), Positives = 22/37 (59%) Frame = +2 Query: 347 PTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRN 457 P +FV L T ++ +F +FGT++ C+++R+ Sbjct: 118 PDNVLFVCKLNPVTTDEDLEIIFSRFGTILSCEVIRD 154 >SB_2543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 35.9 bits (79), Expect = 0.032 Identities = 14/33 (42%), Positives = 23/33 (69%) Frame = +1 Query: 124 IFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN 222 +++GNL T +DL +FE+YG VV+ I+R+ Sbjct: 12 VYVGNLPYSLTNSDLHKVFERYGKVVKVTILRD 44 >SB_27005| Best HMM Match : NTF2 (HMM E-Value=1.1e-33) Length = 662 Score = 35.1 bits (77), Expect = 0.057 Identities = 13/28 (46%), Positives = 20/28 (71%) Frame = +1 Query: 121 KIFIGNLSDKTTEADLRPLFEKYGTVVE 204 ++FIGNL +AD+ +F KYGT++E Sbjct: 358 QVFIGNLPSGVKDADVNEVFSKYGTILE 385 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/38 (36%), Positives = 25/38 (65%) Frame = +2 Query: 326 SRKAPSTPTTKIFVGNLTDKTRAPEVRELFQKFGTVVE 439 +R AP + ++F+GNL + +V E+F K+GT++E Sbjct: 350 ARSAPDSH--QVFIGNLPSGVKDADVNEVFSKYGTILE 385 >SB_8450| Best HMM Match : RRM_1 (HMM E-Value=1.7e-36) Length = 328 Score = 35.1 bits (77), Expect = 0.057 Identities = 15/31 (48%), Positives = 21/31 (67%) Frame = +1 Query: 121 KIFIGNLSDKTTEADLRPLFEKYGTVVECDI 213 K+F+G LS +TT+ L+ F KYG +V DI Sbjct: 30 KLFVGGLSYETTKESLKEYFSKYGELVGVDI 60 Score = 34.3 bits (75), Expect = 0.099 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 1/56 (1%) Frame = +2 Query: 284 ELVHGQ-AIKIEAAKSRKAPSTPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDI 448 E V+G +++ K+R K+FVG L+ +T ++E F K+G +V DI Sbjct: 5 EAVNGYIGTSLDSNKTRMTKDDDIGKLFVGGLSYETTKESLKEYFSKYGELVGVDI 60 Score = 29.1 bits (62), Expect = 3.7 Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Frame = +2 Query: 317 AAKSRKAPSTPTTKIFVGNLTDKTRAPEVRELFQK-FGTVVECDIVRNY 460 AA K P KIFVG L +T ++RE F K + V E + + + Sbjct: 91 AAPIGKPPHLRVKKIFVGGLKPETSDEKIREYFGKAYAPVKEIEYITEH 139 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 35.1 bits (77), Expect = 0.057 Identities = 16/57 (28%), Positives = 29/57 (50%), Gaps = 6/57 (10%) Frame = +2 Query: 356 KIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRNYG------FVHLDATGDVNDAIK 508 +++VGNL R ++ ++F K+G + + D+ G FV + D DA+K Sbjct: 262 RVYVGNLPQDVREKDLHDIFYKYGHIADVDLKNRRGAGPPFAFVEFEDPRDAEDAVK 318 Score = 33.5 bits (73), Expect = 0.17 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +1 Query: 121 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRNYG 228 ++++GNL E DL +F KYG + + D+ G Sbjct: 262 RVYVGNLPQDVREKDLHDIFYKYGHIADVDLKNRRG 297 >SB_971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 783 Score = 34.7 bits (76), Expect = 0.075 Identities = 22/56 (39%), Positives = 29/56 (51%), Gaps = 7/56 (12%) Frame = +1 Query: 115 TFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVR-------NYGFVHMENEQVAA 261 T +F+GNL + DLR FEK+G V++ DI R Y FV + VAA Sbjct: 236 TRTLFVGNLETGISCQDLRLSFEKFGVVLDVDIKRPARGQGNTYAFVKFADLDVAA 291 Score = 32.7 bits (71), Expect = 0.30 Identities = 15/35 (42%), Positives = 21/35 (60%) Frame = +2 Query: 350 TTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIVR 454 T +FVGNL ++R F+KFG V++ DI R Sbjct: 236 TRTLFVGNLETGISCQDLRLSFEKFGVVLDVDIKR 270 Score = 29.1 bits (62), Expect = 3.7 Identities = 16/52 (30%), Positives = 23/52 (44%) Frame = +2 Query: 290 VHGQAIKIEAAKSRKAPSTPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECD 445 + GQ I K S TT+++VG L PE+ F +FG + D Sbjct: 297 MQGQCIGRNHIKIGYGRSQQTTRLWVGGLGPWISIPELEREFDRFGAIRRID 348 >SB_33046| Best HMM Match : RRM_1 (HMM E-Value=3.6e-13) Length = 1463 Score = 34.7 bits (76), Expect = 0.075 Identities = 17/79 (21%), Positives = 38/79 (48%), Gaps = 2/79 (2%) Frame = +1 Query: 124 IFIGNLSDKTTEADLRPLFEKYGTVVECDIV--RNYGFVHMENEQVAANHSES*RRVSSW 297 I++G+L+ T+ L+ +FE++GT+ D++ R ++ ME + A + R + + Sbjct: 543 IWVGHLAKIVTQDTLQGIFEEHGTITSIDLIPPRGCAYIQMEKREDAYRALDKLRNIKLY 602 Query: 298 AGDQNRSGQEPEGAVDANH 354 + +G D + Sbjct: 603 GNSVKLAWAPAKGVKDREY 621 >SB_28070| Best HMM Match : RRM_1 (HMM E-Value=1.3e-07) Length = 694 Score = 34.7 bits (76), Expect = 0.075 Identities = 17/29 (58%), Positives = 20/29 (68%) Frame = +1 Query: 139 LSDKTTEADLRPLFEKYGTVVECDIVRNY 225 LS TTE DLRP+FEKYG V IV ++ Sbjct: 188 LSLYTTERDLRPVFEKYGPVEAIQIVYDH 216 >SB_2700| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 593 Score = 34.7 bits (76), Expect = 0.075 Identities = 17/54 (31%), Positives = 29/54 (53%), Gaps = 8/54 (14%) Frame = +1 Query: 121 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVA 258 +I+I ++ E D++ +FE +G VV C + + YGF+ EN+Q A Sbjct: 200 RIYIASVHPDLLEDDIKSVFEAFGKVVHCSLSKEPMTGKHKGYGFIEYENQQSA 253 Score = 31.9 bits (69), Expect = 0.53 Identities = 23/100 (23%), Positives = 46/100 (46%), Gaps = 18/100 (18%) Frame = +2 Query: 266 IQNLNGELVHGQAIKIEAAKS--RKAP--------STPTTKIFVGNLTDKTRAPEVRELF 415 ++ +NG L+ G+ IK+ + + AP + +I++ ++ +++ +F Sbjct: 160 LEQMNGVLLGGRNIKVGRPSNVPQAAPLIEQFEQEAKKYARIYIASVHPDLLEDDIKSVF 219 Query: 416 QKFGTVVECDIVRN--------YGFVHLDATGDVNDAIKS 511 + FG VV C + + YGF+ + NDAI S Sbjct: 220 EAFGKVVHCSLSKEPMTGKHKGYGFIEYENQQSANDAIAS 259 >SB_57433| Best HMM Match : RRM_1 (HMM E-Value=4.5e-24) Length = 407 Score = 34.3 bits (75), Expect = 0.099 Identities = 19/60 (31%), Positives = 31/60 (51%) Frame = +2 Query: 278 NGELVHGQAIKIEAAKSRKAPSTPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRN 457 NGE + G I+++ A + KA + +F+GNL +RELF G V ++R+ Sbjct: 32 NGEEIDGFHIRVDLASNDKAHDHQRS-VFIGNLPFDIEEEPLRELFTTCGNVESVRLIRD 90 >SB_52333| Best HMM Match : RRM_1 (HMM E-Value=2.3e-16) Length = 76 Score = 34.3 bits (75), Expect = 0.099 Identities = 14/45 (31%), Positives = 26/45 (57%) Frame = +1 Query: 124 IFIGNLSDKTTEADLRPLFEKYGTVVECDIVRNYGFVHMENEQVA 258 I++ N+ +E L+ +F KYG + + +R+YGFV+ + A Sbjct: 4 IYVRNVPLPMSETQLKAVFTKYGQIEKVRKIRDYGFVYFAKRESA 48 Score = 27.9 bits (59), Expect = 8.6 Identities = 11/38 (28%), Positives = 23/38 (60%) Frame = +2 Query: 359 IFVGNLTDKTRAPEVRELFQKFGTVVECDIVRNYGFVH 472 I+V N+ +++ +F K+G + + +R+YGFV+ Sbjct: 4 IYVRNVPLPMSETQLKAVFTKYGQIEKVRKIRDYGFVY 41 >SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 299 Score = 34.3 bits (75), Expect = 0.099 Identities = 21/56 (37%), Positives = 29/56 (51%), Gaps = 8/56 (14%) Frame = +1 Query: 121 KIFIGNLSDKTTEADLRPLFEKYG----TVVECDIV----RNYGFVHMENEQVAAN 264 K+F+G L+ +TT LR FE YG VV CD R +G+V + +V N Sbjct: 15 KLFVGGLNRETTNETLREYFEAYGELTDVVVICDSATKKSRGFGYVTFADYKVTRN 70 >SB_47831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 34.3 bits (75), Expect = 0.099 Identities = 15/32 (46%), Positives = 21/32 (65%) Frame = +2 Query: 356 KIFVGNLTDKTRAPEVRELFQKFGTVVECDIV 451 K+FVGN+ K RA E+++ F FG VV I+ Sbjct: 80 KVFVGNIGFKVRARELKDFFGYFGDVVYAQII 111 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/58 (27%), Positives = 29/58 (50%), Gaps = 6/58 (10%) Frame = +1 Query: 121 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIV------RNYGFVHMENEQVAANHSES 276 K+F+GN+ K +L+ F +G VV I+ R+ G N ++ A+ ++S Sbjct: 80 KVFVGNIGFKVRARELKDFFGYFGDVVYAQIIMDRVKKRSKGTQDYRNTEILADINQS 137 >SB_11106| Best HMM Match : RRM_1 (HMM E-Value=1.8e-11) Length = 67 Score = 34.3 bits (75), Expect = 0.099 Identities = 16/54 (29%), Positives = 29/54 (53%), Gaps = 2/54 (3%) Frame = +2 Query: 350 TTKIFVGNLTDKTRAPEVRELFQKFGT--VVECDIVRNYGFVHLDATGDVNDAI 505 + ++++G L TR +V++ F +G + E + YGFV D + D DA+ Sbjct: 2 SNRVYLGRLPYGTREDDVKKFFYTYGRFKIREIILKDGYGFVEFDYSDDAEDAV 55 >SB_1873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 389 Score = 33.1 bits (72), Expect = 0.23 Identities = 17/49 (34%), Positives = 26/49 (53%), Gaps = 2/49 (4%) Frame = +1 Query: 124 IFIGNLSDKTTEADLRPLFEKYGTV--VECDIVRNYGFVHMENEQVAAN 264 IF+ L + T L LF YG + +E + + YGFV+M N + A + Sbjct: 274 IFVYGLPQEATPLFLYKLFSPYGAITNIELKLDKGYGFVNMSNYEEACH 322 >SB_37749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1103 Score = 32.7 bits (71), Expect = 0.30 Identities = 16/37 (43%), Positives = 21/37 (56%) Frame = +1 Query: 112 GTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN 222 G +++ NLS T ADL+ F +YG VV IV N Sbjct: 347 GGKSLWVANLSSITRAADLKTRFSQYGKVVGAKIVTN 383 >SB_34757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 435 Score = 32.7 bits (71), Expect = 0.30 Identities = 18/63 (28%), Positives = 33/63 (52%), Gaps = 3/63 (4%) Frame = +2 Query: 290 VHGQAIKIEAAKSRKAPSTPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDI---VRNY 460 + G+ ++ + ++ + P K+FVG L + T + E F +FG V + I R++ Sbjct: 179 IQGRLCEVRLPRPKEELNVPK-KLFVGRLPESTTEKTLMEYFAQFGEVTDVYIPKPFRHF 237 Query: 461 GFV 469 GFV Sbjct: 238 GFV 240 Score = 32.3 bits (70), Expect = 0.40 Identities = 16/41 (39%), Positives = 24/41 (58%), Gaps = 3/41 (7%) Frame = +1 Query: 121 KIFIGNLSDKTTEADLRPLFEKYGTVVECDI---VRNYGFV 234 K+F+G L + TTE L F ++G V + I R++GFV Sbjct: 200 KLFVGRLPESTTEKTLMEYFAQFGEVTDVYIPKPFRHFGFV 240 Score = 28.7 bits (61), Expect = 4.9 Identities = 15/65 (23%), Positives = 32/65 (49%), Gaps = 8/65 (12%) Frame = +1 Query: 94 SKMPGTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDI--------VRNYGFVHMENE 249 +K+ G + + L TTE++++ F ++G + C++ R +GFV + + Sbjct: 107 TKVEGVDVGDLIVLGLPYATTESEMKEYFTRFGEIDFCEVKLDPNTRRSRGFGFVRFKKD 166 Query: 250 QVAAN 264 + A N Sbjct: 167 EDAKN 171 >SB_37198| Best HMM Match : RRM_1 (HMM E-Value=7.8e-23) Length = 362 Score = 32.3 bits (70), Expect = 0.40 Identities = 19/62 (30%), Positives = 32/62 (51%), Gaps = 8/62 (12%) Frame = +1 Query: 103 PGTGTFKIFIGNLSDKTTEADLRPLFEKYGTVV--------ECDIVRNYGFVHMENEQVA 258 PG +FI +L + T+ADL F+ +GTV+ + ++ + +GFV +N A Sbjct: 272 PGPDGSNLFIYHLPQEFTDADLMQTFQPFGTVISAKVFIDKQTNMSKCFGFVSYDNVMSA 331 Query: 259 AN 264 N Sbjct: 332 QN 333 >SB_33676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 828 Score = 32.3 bits (70), Expect = 0.40 Identities = 11/33 (33%), Positives = 21/33 (63%) Frame = +1 Query: 124 IFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN 222 +++ N+ + EA+ R FE YG +V C ++R+ Sbjct: 135 LYVCNIPKQLPEAEFRKAFEAYGNIVNCRLLRD 167 >SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 610 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = +1 Query: 124 IFIGNLSDKTTEADLRPLFEKYGTVVECDIVRNYGFVH 237 +++ NLS TE L+ + +YG V +++Y FVH Sbjct: 331 VYLRNLSPSITEEKLKEEYSQYGAVDRVKKLKDYAFVH 368 >SB_8823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1309 Score = 32.3 bits (70), Expect = 0.40 Identities = 11/45 (24%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Frame = +1 Query: 124 IFIGNLSDKTTEADLRPLFEKYGTVVECDIV--RNYGFVHMENEQ 252 +++GNL + +L+ +F +YG+++E + + Y F++ E+ Sbjct: 617 VYVGNLPPDVKDYELQQMFSQYGSILETKVFADKGYAFINARGEK 661 Score = 31.1 bits (67), Expect = 0.92 Identities = 17/66 (25%), Positives = 28/66 (42%), Gaps = 6/66 (9%) Frame = +2 Query: 323 KSRKAPSTPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRN------YGFVHLDAT 484 ++R P ++VGNL K + +F K VV C ++ + Y FV + Sbjct: 359 RARYFPEEENRSLYVGNLDPKCTQELICSIFNKIAKVVRCKMINSPTDKGPYCFVEFETH 418 Query: 485 GDVNDA 502 D +A Sbjct: 419 ADAQEA 424 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +1 Query: 124 IFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN 222 +++GNL K T+ + +F K VV C ++ + Sbjct: 371 LYVGNLDPKCTQELICSIFNKIAKVVRCKMINS 403 >SB_6474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 31.9 bits (69), Expect = 0.53 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = +1 Query: 121 KIFIGNLSDKTTEADLRPLFEKYGTV 198 K+FIG L+ TTE DL+ F YG V Sbjct: 203 KVFIGGLAFGTTEEDLKEYFSTYGMV 228 >SB_3033| Best HMM Match : RRM_1 (HMM E-Value=2.3e-20) Length = 1313 Score = 31.5 bits (68), Expect = 0.70 Identities = 12/42 (28%), Positives = 24/42 (57%) Frame = +2 Query: 323 KSRKAPSTPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDI 448 + +++P+ TK++V +LT V+E+F +G V D+ Sbjct: 1147 RRKRSPTPKPTKLYVAHLTRNVNKDHVQEIFSVYGRVKTVDL 1188 Score = 28.3 bits (60), Expect = 6.5 Identities = 27/86 (31%), Positives = 38/86 (44%), Gaps = 14/86 (16%) Frame = +1 Query: 490 CERRYQKLNGMMVDGQPMKVQ---------LSTSRVRQRPGMGDPEQCYRC-----GRGG 627 CE+ + ++G +DGQ + VQ + + R P P+Q R G GG Sbjct: 1211 CEKALKHMDGGQIDGQEIAVQSVLPPRPRDVRPAYRRPSPPRRRPQQWRRSPPRFRGGGG 1270 Query: 628 PLVQRSARSAGPRPQRFPRSSVRPRS 705 R +RS P P+R RS R RS Sbjct: 1271 FRPMRRSRSGSPPPRR-RRSPSRSRS 1295 >SB_50249| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 420 Score = 31.5 bits (68), Expect = 0.70 Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 7/49 (14%) Frame = +1 Query: 124 IFIGNLSDKTTEADLRPLFEKYGTVVECDIV-------RNYGFVHMENE 249 +F+G L+ T E L+ FE++G V I+ RNYGFV +++ Sbjct: 82 VFVGGLASGTDEEGLKDYFEQFGEVESVRIMRTFLGYSRNYGFVLFKDD 130 Score = 29.9 bits (64), Expect = 2.1 Identities = 18/57 (31%), Positives = 27/57 (47%), Gaps = 7/57 (12%) Frame = +2 Query: 359 IFVGNLTDKTRAPEVRELFQKFGTVVECDIV-------RNYGFVHLDATGDVNDAIK 508 +FVG L T +++ F++FG V I+ RNYGFV G + +K Sbjct: 82 VFVGGLASGTDEEGLKDYFEQFGEVESVRIMRTFLGYSRNYGFVLFKDDGPSKEVLK 138 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = +1 Query: 88 P*SKMPGTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV 216 P + G +F+ NLS+ T E D+ F YG V + I+ Sbjct: 309 PNEEKQGVRERTLFVDNLSEDTKELDVLRYFRPYGQVAKVHIL 351 >SB_45423| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 514 Score = 31.5 bits (68), Expect = 0.70 Identities = 17/62 (27%), Positives = 30/62 (48%), Gaps = 8/62 (12%) Frame = +1 Query: 112 GTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVAANH 267 G ++++G+L TEA ++ +FE +GTV ++ + YGFV + A Sbjct: 240 GPTRLYVGSLHFNITEAMVKAVFEPFGTVDSVQLIYDSETNRSKGYGFVQFREAEAAKRA 299 Query: 268 SE 273 E Sbjct: 300 ME 301 >SB_53070| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 347 Score = 31.1 bits (67), Expect = 0.92 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 103 PGTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDI 213 PG +FI +L + T+ADL F+ +GTV+ + Sbjct: 224 PGPDGSNLFIYHLPQEFTDADLMQTFQPFGTVISAKV 260 >SB_44114| Best HMM Match : RRM_1 (HMM E-Value=9.9e-35) Length = 929 Score = 31.1 bits (67), Expect = 0.92 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +1 Query: 103 PGTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECD 210 P + + + NLS +T+ DL+ F KYG V D Sbjct: 793 PVRTNYSVIVENLSSRTSWQDLKDYFRKYGKVTYAD 828 Score = 30.3 bits (65), Expect = 1.6 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +2 Query: 389 RAPEVRELFQKFGTVVECDIVRNYGFVHLDATGDVNDAI 505 R +V + + +G + + + R YGFV D D DA+ Sbjct: 701 RESDVEKFLRGYGKIRDISLKRGYGFVEFDDHRDAEDAV 739 >SB_9401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 321 Score = 31.1 bits (67), Expect = 0.92 Identities = 20/60 (33%), Positives = 30/60 (50%) Frame = +2 Query: 59 IYCYSLYIVTHNLKCRAPVLSKSSSGTFLIKPQKPILDRYSKNTVRS*NAISSEITVSCT 238 IYC S + V + APVL K + T +I+P P+ ++ N AI E+ +S T Sbjct: 186 IYCASKFAVEGYAEAMAPVLGKFNIKTTIIEP-GPVATNFASNA----KAIRDEVDISGT 240 >SB_39433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1291 Score = 30.7 bits (66), Expect = 1.2 Identities = 17/67 (25%), Positives = 33/67 (49%) Frame = +2 Query: 257 PRTIQNLNGELVHGQAIKIEAAKSRKAPSTPTTKIFVGNLTDKTRAPEVRELFQKFGTVV 436 P+ Q + G + ++ + S P +P KIF+G L + +V+EL FG + Sbjct: 643 PKDYQPIPG-MSENASVHVPGVVSTVVPDSPH-KIFIGGLPNYLNEDQVKELLSSFGELR 700 Query: 437 ECDIVRN 457 ++V++ Sbjct: 701 AFNLVKD 707 >SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 30.7 bits (66), Expect = 1.2 Identities = 17/45 (37%), Positives = 24/45 (53%) Frame = +1 Query: 493 ERRYQKLNGMMVDGQPMKVQLSTSRVRQRPGMGDPEQCYRCGRGG 627 ++ K +G +DG+PMKV + R +R G G YR G GG Sbjct: 64 DKAIDKFDGEDLDGRPMKVNKAQPR-GERGGGGSQGGGYRSGGGG 107 Score = 29.9 bits (64), Expect = 2.1 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +1 Query: 121 KIFIGNLSDKTTEADLRPLFEKYGTV 198 K +IGNL K EADL+ F +Y V Sbjct: 231 KCYIGNLDFKVNEADLQDRFSRYDVV 256 Score = 27.9 bits (59), Expect = 8.6 Identities = 17/45 (37%), Positives = 23/45 (51%) Frame = +1 Query: 493 ERRYQKLNGMMVDGQPMKVQLSTSRVRQRPGMGDPEQCYRCGRGG 627 E +L+G DG+ MKV + SR ++ G G YR G GG Sbjct: 284 EDAINELDGQEFDGRSMKVNQARSREQRGGGRGGG---YRSGGGG 325 >SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 732 Score = 30.3 bits (65), Expect = 1.6 Identities = 14/47 (29%), Positives = 20/47 (42%) Frame = +1 Query: 88 P*SKMPGTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRNYG 228 P +P +F+GNLS E L FE+ G C ++ G Sbjct: 170 PKKTVPAKEEMSVFLGNLSFDADEETLAAFFEEKGLSATCRVITQEG 216 >SB_39475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 333 Score = 30.3 bits (65), Expect = 1.6 Identities = 17/56 (30%), Positives = 26/56 (46%), Gaps = 7/56 (12%) Frame = +2 Query: 359 IFVGNLTDKTRAPEVRELFQKFGTVVECDIVRN-------YGFVHLDATGDVNDAI 505 +FV NL + E+ ELF K G V + +V N YG+V + + A+ Sbjct: 173 LFVSNLPFDAKESEIEELFSKHGVVKQVRLVTNRAGKPKGYGYVEYEQESSASTAV 228 >SB_18756| Best HMM Match : Sterol_desat (HMM E-Value=0) Length = 672 Score = 30.3 bits (65), Expect = 1.6 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +1 Query: 118 FKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN 222 F+IF G+L + T+ L F KY + ++ IVR+ Sbjct: 217 FRIFCGDLGSEVTDESLTRAFAKYTSFLKAKIVRD 251 >SB_463| Best HMM Match : RRM_1 (HMM E-Value=3.3e-16) Length = 842 Score = 30.3 bits (65), Expect = 1.6 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +2 Query: 344 TPTTKIFVGNLTDKTRAPEVRELFQKFGTV 433 T T KIF+G L+ T ++++ F +FG V Sbjct: 180 TTTKKIFIGGLSTNTSEEDMKKYFSQFGKV 209 >SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 29.9 bits (64), Expect = 2.1 Identities = 18/59 (30%), Positives = 33/59 (55%), Gaps = 8/59 (13%) Frame = +2 Query: 356 KIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRN--------YGFVHLDATGDVNDAIK 508 K+++GNL + E+ + F++FG V + DI+R+ +GFV L + + AI+ Sbjct: 10 KLYIGNLNFNSDEGEIEQAFEEFG-VEKVDILRDKESGRSRGFGFVLLQSADQIAPAIE 67 Score = 29.9 bits (64), Expect = 2.1 Identities = 13/34 (38%), Positives = 24/34 (70%) Frame = +1 Query: 121 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN 222 K++IGNL+ + E ++ FE++G V + DI+R+ Sbjct: 10 KLYIGNLNFNSDEGEIEQAFEEFG-VEKVDILRD 42 >SB_28139| Best HMM Match : RRM_1 (HMM E-Value=3.7e-28) Length = 419 Score = 29.9 bits (64), Expect = 2.1 Identities = 20/62 (32%), Positives = 31/62 (50%), Gaps = 13/62 (20%) Frame = +1 Query: 100 MPGTGTFKI-----FIGNLSDKTTEADLRPLFEKYGTVV--------ECDIVRNYGFVHM 240 +P TG K+ +I L TT+ DL L KYGT++ + ++ + YGFV Sbjct: 89 LPDTGEEKLSKTNLYIRGLKANTTDDDLVRLCHKYGTIISTKAILDKDTNLCKGYGFVDF 148 Query: 241 EN 246 E+ Sbjct: 149 ES 150 >SB_3536| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 1026 Score = 29.9 bits (64), Expect = 2.1 Identities = 11/31 (35%), Positives = 21/31 (67%) Frame = +1 Query: 124 IFIGNLSDKTTEADLRPLFEKYGTVVECDIV 216 +FI NLS +T+ ++ LF+++G + C +V Sbjct: 418 VFIRNLSFDSTQKNITNLFKQFGDIAYCKVV 448 >SB_50664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 173 Score = 29.5 bits (63), Expect = 2.8 Identities = 24/67 (35%), Positives = 35/67 (52%), Gaps = 6/67 (8%) Frame = -3 Query: 609 VALLGVAHARPLPD---TTRRQLHLH-GLSVD-HHTVQLLIASFTSPVASKCTKP*LR-T 448 ++L+G+A +R LPD T ++ LH +SVD +TV L + S CTK R Sbjct: 72 ISLIGIAASRSLPDDSFTCALRVFLHCFVSVDASNTVALCNMAIASRAIRNCTKNVRRQL 131 Query: 447 ISHSTTV 427 + HS V Sbjct: 132 VKHSNVV 138 >SB_47771| Best HMM Match : Annexin (HMM E-Value=0) Length = 529 Score = 29.1 bits (62), Expect = 3.7 Identities = 13/38 (34%), Positives = 24/38 (63%) Frame = +2 Query: 398 EVRELFQKFGTVVECDIVRNYGFVHLDATGDVNDAIKS 511 ++R L+Q + V +CDI+ + + TGD +DA+K+ Sbjct: 436 QLRALYQAYQHVAKCDILET---IDDELTGDYHDAVKA 470 >SB_46599| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4482 Score = 29.1 bits (62), Expect = 3.7 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +2 Query: 227 VSCTWKTNKWPRTIQNLNGELVHGQAIKIEAAKSRKAP 340 + C WK PR + + L+ G ++ EAA+ R AP Sbjct: 1636 IKCFWKVLNTPRAFHSFHMALIEGTFLQ-EAARKRLAP 1672 >SB_28089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 254 Score = 29.1 bits (62), Expect = 3.7 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = +1 Query: 121 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRNYGFVHMEN 246 +++ G L E DL YG V E + YGFV ++ Sbjct: 6 RVYFGRLPRDCRERDLEKFVRGYGRVREISMKLGYGFVEFDD 47 >SB_15297| Best HMM Match : RRM_1 (HMM E-Value=2.2e-18) Length = 291 Score = 28.7 bits (61), Expect = 4.9 Identities = 18/57 (31%), Positives = 31/57 (54%), Gaps = 8/57 (14%) Frame = +2 Query: 344 TPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRN--------YGFVHLDATGD 490 T TK+FVG + ++ +R+ F +FG + E ++++ YGFV + AT D Sbjct: 7 TKFTKLFVGGIPYESGDDALRKFFAQFGEIREAVVIKDRVTKKSKGYGFVTM-ATSD 62 >SB_43251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 28.7 bits (61), Expect = 4.9 Identities = 13/37 (35%), Positives = 23/37 (62%) Frame = +1 Query: 112 GTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN 222 G + + NL+ +TT DL+ +F+KYG + + I R+ Sbjct: 14 GMTSLKVDNLTYRTTVEDLKQVFKKYGDLGDIYIPRD 50 >SB_41255| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 321 Score = 28.7 bits (61), Expect = 4.9 Identities = 15/49 (30%), Positives = 22/49 (44%) Frame = +2 Query: 203 NAISSEITVSCTWKTNKWPRTIQNLNGELVHGQAIKIEAAKSRKAPSTP 349 N SS IT+ T+K + P T L V+ + + AP+TP Sbjct: 114 NHWSSSITLKATYKHRQHPNTCNGLPITTVYSPTVSPSYGRGCSAPTTP 162 >SB_40368| Best HMM Match : SASP_gamma (HMM E-Value=2.3) Length = 325 Score = 28.7 bits (61), Expect = 4.9 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +3 Query: 564 SCPAAAGHGRPRAVLPLWPRGATGPKECPKR 656 +CPA H + P+ PR GP E P R Sbjct: 68 TCPAEKHHRSSKETPPVQPRNLAGPAEKPHR 98 >SB_19711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 203 Score = 28.7 bits (61), Expect = 4.9 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +1 Query: 124 IFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN 222 + I NL E DL+ L + YG V+ C+I R+ Sbjct: 121 LIIQNLPKGIQEKDLKELLQLYGNVLVCNIERD 153 >SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) Length = 159 Score = 28.3 bits (60), Expect = 6.5 Identities = 16/45 (35%), Positives = 22/45 (48%) Frame = +1 Query: 493 ERRYQKLNGMMVDGQPMKVQLSTSRVRQRPGMGDPEQCYRCGRGG 627 E+ + +G DG+PMKV + R + G G YR G GG Sbjct: 59 EKAIDEFDGQDFDGRPMKVNQAQPRGERGAG-GSRAGGYRSGGGG 102 >SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 28.3 bits (60), Expect = 6.5 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = +1 Query: 121 KIFIGNLSDKTTEADLRPLFEKYGTVVECDI 213 K+F+G L++ TTE +R F+ + E D+ Sbjct: 9 KLFVGGLNEDTTEETVRAYFKSFCEGSEADV 39 >SB_42891| Best HMM Match : DUF537 (HMM E-Value=1.2e-23) Length = 2386 Score = 28.3 bits (60), Expect = 6.5 Identities = 27/97 (27%), Positives = 46/97 (47%), Gaps = 7/97 (7%) Frame = +2 Query: 188 TVRS*NAISSEITVSCTW-----KT-NKWP-RTIQNLNGELVHGQAIKIEAAKSRKAPST 346 T+R+ N + SE+ S + KT N W R + +L G + + + A S Sbjct: 465 TIRTWNLLPSEVVESSSIDSFKSKTGNDWLFRQLPSLQGPCIAFWVFQEVNEGFKMAASF 524 Query: 347 PTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRN 457 P +++G L++ + ELF KFG V + I+R+ Sbjct: 525 P---VWIGGLSEDVTENVLLELFNKFGPVKDVVILRD 558 >SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33) Length = 392 Score = 27.9 bits (59), Expect = 8.6 Identities = 13/53 (24%), Positives = 28/53 (52%), Gaps = 8/53 (15%) Frame = +1 Query: 124 IFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVHMENEQVA 258 +F+GN+ + +E L+ +F + G V+ +V + YGF ++++ A Sbjct: 27 VFVGNIPYEASEEQLKEIFSEVGPVISFRLVFDRETGKPKGYGFCEYKDQETA 79 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 27.9 bits (59), Expect = 8.6 Identities = 13/58 (22%), Positives = 28/58 (48%) Frame = +2 Query: 266 IQNLNGELVHGQAIKIEAAKSRKAPSTPTTKIFVGNLTDKTRAPEVRELFQKFGTVVE 439 I+ +N V+G+ I++ A + +F+GNL + + + F FG +++ Sbjct: 71 IKVMNMIKVYGKPIRVNKASAHNKNLDVGANLFIGNLDTEVDEKLLYDTFSAFGVILQ 128 >SB_34189| Best HMM Match : MAM (HMM E-Value=5.60519e-45) Length = 649 Score = 27.9 bits (59), Expect = 8.6 Identities = 21/104 (20%), Positives = 38/104 (36%) Frame = +2 Query: 98 KCRAPVLSKSSSGTFLIKPQKPILDRYSKNTVRS*NAISSEITVSCTWKTNKWPRTIQNL 277 K A + + + TFL + S +T + + +++ T + + T K T Sbjct: 417 KATASTQTAAEANTFLSTQKTDATTSQSTSTTEATKSQTTKATTTLSTSTTKATTTSSTS 476 Query: 278 NGELVHGQAIKIEAAKSRKAPSTPTTKIFVGNLTDKTRAPEVRE 409 + + K+ PST TTK + T +P E Sbjct: 477 TTKAT--TTLSTSTTKATTTPSTSTTKATTSTAVEATTSPAATE 518 >SB_48623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 369 Score = 27.9 bits (59), Expect = 8.6 Identities = 28/108 (25%), Positives = 41/108 (37%) Frame = -2 Query: 646 HSFGPVAPRGHSGSTARGRPCPAAAGHDSSTTAPSWAVRRPSYRSTFDSVVHIARRVQMH 467 H+ PV PR ST PC +A S + ++ S F SV ++ M Sbjct: 40 HTLAPVGPR-RDASTVY-YPCSSATMTTVYYPCSSATMDSSAWNSRFASVKLHRQKNYMA 97 Query: 466 EAVVTHDIALDDRPELLKQLADFGRARLVR*ITHEYFSGWRRRRLPAL 323 + T R + D R L+ ITH F+ + RR+ L Sbjct: 98 TSTRTKRFKQQLRSMWDLESCDLARVMLIVRITHATFASLKLRRISKL 145 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 27.9 bits (59), Expect = 8.6 Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 2/39 (5%) Frame = +1 Query: 124 IFIGNLSDKTTEADLRPLFEKYGTVVECDIV--RNYGFV 234 +++G L K TE DLR F ++G + +V +N FV Sbjct: 306 LYVGGLEGKVTEQDLRDHFYQFGELRSISMVPRQNCAFV 344 >SB_9866| Best HMM Match : TP2 (HMM E-Value=0.27) Length = 1019 Score = 27.9 bits (59), Expect = 8.6 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = -2 Query: 634 PVAPRGHSGSTARGRPCPAAAGHDSSTTAPSWAVRRPSY 518 P+APRG SGS G P H S W V SY Sbjct: 294 PIAPRGPSGSYPAGAP---DVSHRGSPLGSPWRVPYLSY 329 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,495,700 Number of Sequences: 59808 Number of extensions: 524989 Number of successful extensions: 1841 Number of sequences better than 10.0: 66 Number of HSP's better than 10.0 without gapping: 1543 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1834 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1877743452 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -