BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021163 (710 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value L01589-1|AAA27736.1| 81|Apis mellifera zinc finger protein pro... 21 8.7 EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 21 8.7 AF393495-1|AAL60420.1| 136|Apis mellifera odorant binding prote... 21 8.7 AF393492-1|AAL60417.1| 136|Apis mellifera odorant binding prote... 21 8.7 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 21 8.7 >L01589-1|AAA27736.1| 81|Apis mellifera zinc finger protein protein. Length = 81 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/26 (30%), Positives = 16/26 (61%) Frame = +2 Query: 74 LYIVTHNLKCRAPVLSKSSSGTFLIK 151 ++I TH L C+ + K+ S +L++ Sbjct: 34 MHIRTHTLPCKCHLCGKAFSRPWLLQ 59 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 511 LNGMMVDGQPMKVQLSTSR 567 LNG+ G+P +QL + R Sbjct: 318 LNGLEFAGRPQNLQLQSQR 336 >AF393495-1|AAL60420.1| 136|Apis mellifera odorant binding protein ASP4 protein. Length = 136 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = +2 Query: 32 LVFIFLTCVIYCYSLYIVTHNLKC 103 + + L CVIYC ++ T + C Sbjct: 3 ITIVSLLCVIYCALVHADTVAILC 26 >AF393492-1|AAL60417.1| 136|Apis mellifera odorant binding protein ASP4 protein. Length = 136 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = +2 Query: 32 LVFIFLTCVIYCYSLYIVTHNLKC 103 + + L CVIYC ++ T + C Sbjct: 3 ITIVSLLCVIYCALVHADTVAILC 26 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.4 bits (43), Expect = 8.7 Identities = 10/38 (26%), Positives = 18/38 (47%) Frame = -2 Query: 577 AAGHDSSTTAPSWAVRRPSYRSTFDSVVHIARRVQMHE 464 ++G DS ++ SW S + +V + V +HE Sbjct: 1068 SSGSDSGSSNGSWTAGTVSQQKQKRRMVKYGKLVMIHE 1105 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 209,546 Number of Sequences: 438 Number of extensions: 4616 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21926700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -