BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021161 (753 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-09 SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) 60 3e-09 SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) 54 9e-08 SB_43842| Best HMM Match : RNB (HMM E-Value=0) 52 4e-07 SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22) 47 4e-07 SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) 52 5e-07 SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_17563| Best HMM Match : DEAD (HMM E-Value=0) 42 5e-04 SB_2247| Best HMM Match : DEAD (HMM E-Value=0) 42 5e-04 SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) 41 0.001 SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.062 SB_52320| Best HMM Match : DEAD (HMM E-Value=0) 34 0.11 SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) 32 0.57 SB_49218| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) 31 1.3 SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_6554| Best HMM Match : Isy1 (HMM E-Value=0) 30 1.8 SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) 30 2.3 SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069) 29 4.1 SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_26138| Best HMM Match : RhoGEF (HMM E-Value=0.0011) 29 4.1 SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_19782| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.4 SB_8125| Best HMM Match : MFS_1 (HMM E-Value=3.2e-07) 28 9.4 >SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 790 Score = 76.6 bits (180), Expect = 2e-14 Identities = 48/148 (32%), Positives = 70/148 (47%), Gaps = 2/148 (1%) Frame = +1 Query: 241 PRLGFVSLQPFNKNFYDPHPTVLKRSPYEVEEYKNNHEVTVSGVEVHNPIQYFEEANFPD 420 P + +PFNKNFY+ HP + K+S E+++ + + VSG P F F + Sbjct: 467 PEKSKIDYKPFNKNFYEEHPEITKQSKQEIDDLRKKMGIKVSGAMPARPCISFAHFGFDE 526 Query: 421 YVQQGVKTMGYKEPTPIQAQGWPIAMSGK--I*LAYSNGFRQNVGLHLASHCAHKQPTAY 594 + ++ + Y +PT IQ Q PIA+SG+ I +A + + L A QP Sbjct: 527 QMMASIRKLEYTQPTQIQCQALPIALSGRDIIGIAKTGSGKTAAFLWPALVHIMDQPELQ 586 Query: 595 SER*WSDCLVLAPTRELAQQIQQVAADF 678 L+ APTREL QQI A F Sbjct: 587 VGD-GPIVLICAPTRELCQQIYTEARRF 613 Score = 46.8 bits (106), Expect = 2e-05 Identities = 19/31 (61%), Positives = 26/31 (83%) Frame = +2 Query: 524 QTGSGKTLAYILPAIVHINNQPPIRRGDGPI 616 +TGSGKT A++ PA+VHI +QP ++ GDGPI Sbjct: 562 KTGSGKTAAFLWPALVHIMDQPELQVGDGPI 592 >SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 592 Score = 57.2 bits (132), Expect(2) = 1e-09 Identities = 29/85 (34%), Positives = 47/85 (55%), Gaps = 1/85 (1%) Frame = +1 Query: 256 VSLQPFNKNFYDPHPTVLKRSPYEVEEYKNNHE-VTVSGVEVHNPIQYFEEANFPDYVQQ 432 V QPF K+FY P + K +P E +E++ + E + V G P++ + + + Sbjct: 59 VVYQPFRKDFYVEVPELAKMTPEETDEFRLSLENIHVRGKNAPKPVKTWAQTGVQLKILD 118 Query: 433 GVKTMGYKEPTPIQAQGWPIAMSGK 507 +K Y++PTPIQAQ P+ MSG+ Sbjct: 119 VLKKNSYEKPTPIQAQAIPVIMSGR 143 Score = 23.0 bits (47), Expect(2) = 1e-09 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +1 Query: 619 LVLAPTRELAQQIQQVAADF 678 +V+ PTRELA QI + F Sbjct: 148 IVMTPTRELAIQIHRECKKF 167 >SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) Length = 690 Score = 59.7 bits (138), Expect = 3e-09 Identities = 26/56 (46%), Positives = 37/56 (66%) Frame = +1 Query: 313 RSPYEVEEYKNNHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQ 480 R +EV+ Y+ + ++TV+G V P+ FEE+ FPDY+Q K G+ EPT IQAQ Sbjct: 57 RGQHEVDAYRRSKDLTVNGRNVPKPVTTFEESAFPDYIQSYFKREGFTEPTMIQAQ 112 Score = 39.9 bits (89), Expect = 0.002 Identities = 19/55 (34%), Positives = 30/55 (54%) Frame = +2 Query: 551 YILPAIVHINNQPPIRRGDGPIAWSWRLPES*HNKFSKLLQIFGHTSYVRNTCVF 715 +ILP IVHIN+QP ++ GDGPI + ++ G +R+TC++ Sbjct: 113 FILPGIVHINHQPLLQPGDGPIVLVLCPTRELAQQVQEVAYSVGKHCKLRSTCIY 167 >SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) Length = 500 Score = 54.4 bits (125), Expect = 9e-08 Identities = 23/74 (31%), Positives = 41/74 (55%) Frame = +1 Query: 286 YDPHPTVLKRSPYEVEEYKNNHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPT 465 Y HPT+ + +V++ ++ E+ V G V +P+ F +F + + + + GY PT Sbjct: 161 YKEHPTIAALTAEQVKQLRDKMEIKVKGEHVVSPVLEFFHCSFNESLSKNLSNHGYHSPT 220 Query: 466 PIQAQGWPIAMSGK 507 PIQ Q P+ +SG+ Sbjct: 221 PIQMQVLPVLLSGR 234 >SB_43842| Best HMM Match : RNB (HMM E-Value=0) Length = 1238 Score = 52.4 bits (120), Expect = 4e-07 Identities = 39/132 (29%), Positives = 62/132 (46%), Gaps = 3/132 (2%) Frame = +1 Query: 271 FNKNFYDPHPTVLKRSPYEVEEYKNNHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMG 450 F ++YD + V + S V+E + + + + G + PI+ F + N P + + Sbjct: 32 FMWSYYDENEKVSRLSDEVVDEIRWKNGIHIEGEDCPKPIESFHDLNLPPELSTYLAKKN 91 Query: 451 YKEPTPIQAQGWPIAMSGK--I*LAYS-NGFRQNVGLHLASHCAHKQPTAYSER*WSDCL 621 ++ PTPIQ Q MSG+ I LA + +G L L K P+ + L Sbjct: 92 FQVPTPIQMQSLSCVMSGRDIIGLAETGSGKTLAYSLPLCMLLRTKAPSNPGDT--PVAL 149 Query: 622 VLAPTRELAQQI 657 +L PTREL QQ+ Sbjct: 150 ILTPTRELMQQV 161 >SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22) Length = 1058 Score = 47.2 bits (107), Expect(2) = 4e-07 Identities = 21/64 (32%), Positives = 34/64 (53%), Gaps = 4/64 (6%) Frame = +1 Query: 325 EVEEYKNNHEVTVSGVEVHNPIQYF----EEANFPDYVQQGVKTMGYKEPTPIQAQGWPI 492 ++ +++ + V G +V +P++ F E FPDY+ V+ GY PTPIQ Q P+ Sbjct: 137 KINLFRHEQHIYVKGADVPDPVETFSQLIERYGFPDYIIHNVQERGYTTPTPIQMQATPL 196 Query: 493 AMSG 504 G Sbjct: 197 MAHG 200 Score = 24.6 bits (51), Expect(2) = 4e-07 Identities = 10/13 (76%), Positives = 13/13 (100%) Frame = +1 Query: 619 LVLAPTRELAQQI 657 +V++PTRELAQQI Sbjct: 209 VVVSPTRELAQQI 221 >SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) Length = 428 Score = 52.0 bits (119), Expect = 5e-07 Identities = 34/119 (28%), Positives = 54/119 (45%), Gaps = 5/119 (4%) Frame = +1 Query: 337 YKNNHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKI*L 516 ++ + ++ G + PI+ ++EA PD + + V +GYK+PTPIQ Q PI + + + Sbjct: 83 FREDFNISTKGGRIPFPIRKWKEAQIPDSILEIVDKLGYKDPTPIQRQAIPIGLQNRDII 142 Query: 517 AYSNGFRQNVGLHLASHCAHKQPTAYSER-----*WSDCLVLAPTRELAQQIQQVAADF 678 + ER L+LAPTRELAQQI++ F Sbjct: 143 GVAETGSGKTAAFAIPLLVWIMGLPKIERDNDADQGPYALILAPTRELAQQIEEEILKF 201 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = +2 Query: 524 QTGSGKTLAYILPAIVHINNQPPIRR 601 +TGSGKT A+ +P +V I P I R Sbjct: 146 ETGSGKTAAFAIPLLVWIMGLPKIER 171 >SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 50.0 bits (114), Expect = 2e-06 Identities = 38/114 (33%), Positives = 54/114 (47%), Gaps = 5/114 (4%) Frame = +1 Query: 352 EVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKI*LAYS-N 528 EV VSG I FEEAN + V+ YK+PTP+Q PI ++G+ +A + Sbjct: 698 EVLVSGNNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAGRDVMACAQT 757 Query: 529 GFRQNVGLHL----ASHCAHKQPTAYSER*WSDCLVLAPTRELAQQIQQVAADF 678 G + L + A +++SE + +APTRELA QI A F Sbjct: 758 GSGKTAAFLLPVMTSMMNAGLTSSSFSETQTPQAMCIAPTRELANQIYLEARKF 811 >SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 797 Score = 43.6 bits (98), Expect = 2e-04 Identities = 32/110 (29%), Positives = 46/110 (41%), Gaps = 1/110 (0%) Frame = +1 Query: 361 VSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKI*LAYSNGFRQ 540 VSG I F E F + + + GY+ PTP+Q PI M+G+ +A + Sbjct: 469 VSGENQPPKITSFNELPFGEQLMANISRAGYRRPTPVQKAALPIVMAGRDLMACAQTGSG 528 Query: 541 NVGLHLASHCAHKQPTAYSER*WSD-CLVLAPTRELAQQIQQVAADFWTH 687 ++ + S L +APTRELA+QI A F H Sbjct: 529 KTAAYMLPVLTSLIKQGLNAPPRSPLALCVAPTRELAKQIYIEARKFSDH 578 Score = 29.5 bits (63), Expect = 3.1 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +2 Query: 524 QTGSGKTLAYILPAIVHINNQ 586 QTGSGKT AY+LP + + Q Sbjct: 524 QTGSGKTAAYMLPVLTSLIKQ 544 >SB_17563| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 41.9 bits (94), Expect = 5e-04 Identities = 27/98 (27%), Positives = 44/98 (44%) Frame = +1 Query: 397 FEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKI*LAYSNGFRQNVGLHLASHCAH 576 FE+ + G+ G+ +P+PIQ + P+A++G+ LA + +L Sbjct: 49 FEDYCLKRELLMGIFEKGFDKPSPIQEESIPVALAGRDILARAKNGTGKTAAYLVPLLER 108 Query: 577 KQPTAYSER*WSDCLVLAPTRELAQQIQQVAADFWTHI 690 T + LVL PTRELA Q Q+ + H+ Sbjct: 109 TDTT----KNCIQALVLVPTRELALQTSQICIELGKHM 142 >SB_2247| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 41.9 bits (94), Expect = 5e-04 Identities = 27/98 (27%), Positives = 44/98 (44%) Frame = +1 Query: 397 FEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKI*LAYSNGFRQNVGLHLASHCAH 576 FE+ + G+ G+ +P+PIQ + P+A++G+ LA + +L Sbjct: 49 FEDYCLKRELLMGIFEKGFDKPSPIQEESIPVALAGRDILARAKNGTGKTAAYLVPLLER 108 Query: 577 KQPTAYSER*WSDCLVLAPTRELAQQIQQVAADFWTHI 690 T + LVL PTRELA Q Q+ + H+ Sbjct: 109 TDTT----KNCIQALVLVPTRELALQTSQICIELGKHM 142 >SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) Length = 185 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/52 (40%), Positives = 28/52 (53%) Frame = +1 Query: 352 EVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGK 507 EV VSG I FEEAN + V+ YK+PTP+Q PI ++G+ Sbjct: 121 EVLVSGNNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAGR 172 >SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 478 Score = 35.1 bits (77), Expect = 0.062 Identities = 19/30 (63%), Positives = 22/30 (73%), Gaps = 3/30 (10%) Frame = +1 Query: 586 TAYSER*WSDC---LVLAPTRELAQQIQQV 666 T Y ++ DC LVLAPTRELAQQIQ+V Sbjct: 149 TNYKDKNGCDCCQALVLAPTRELAQQIQKV 178 >SB_52320| Best HMM Match : DEAD (HMM E-Value=0) Length = 340 Score = 34.3 bits (75), Expect = 0.11 Identities = 25/93 (26%), Positives = 39/93 (41%) Frame = +1 Query: 388 IQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKI*LAYSNGFRQNVGLHLASH 567 ++ F + G+ G+ PT IQ QG P+A+SG+ L + L Sbjct: 49 VEKFSDFPISKRTLDGLMKAGFVTPTDIQKQGIPVALSGRDVLGAAKTGSGKTLAFLIPI 108 Query: 568 CAHKQPTAYSER*WSDCLVLAPTRELAQQIQQV 666 ++ LV++PTRELA Q +V Sbjct: 109 IETLWRQKWTSMDGLGALVISPTRELAYQTFEV 141 >SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) Length = 96 Score = 31.9 bits (69), Expect = 0.57 Identities = 25/78 (32%), Positives = 36/78 (46%), Gaps = 3/78 (3%) Frame = +1 Query: 430 QGVKTMGYKEPTPIQAQGWPIAMSGK---I*LAYSNGFRQNVGLHLASHCAHKQPTAYSE 600 + V +G+ PTPIQA P+A+ GK A G L + ++ + + Sbjct: 23 RAVNELGFLHPTPIQASTIPVALMGKDVCACAATGTGKTAAFMLPILERLLYRPTQSPAI 82 Query: 601 R*WSDCLVLAPTRELAQQ 654 R LV+ PTRELA Q Sbjct: 83 R----VLVITPTRELAIQ 96 >SB_49218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 480 Score = 30.7 bits (66), Expect = 1.3 Identities = 11/38 (28%), Positives = 17/38 (44%) Frame = +1 Query: 373 EVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGW 486 ++H P++ + FP Y + Y P P QA W Sbjct: 6 DIHGPVRKLHKHGFPGYEEDYAAVFKYPTPWPEQAMEW 43 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 30.7 bits (66), Expect = 1.3 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = +1 Query: 388 IQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGK 507 I FE+ + + + V GYK+PTP+Q PI + GK Sbjct: 874 ILQFEDVDLGEILLHNVGLAGYKKPTPVQKYAIPI-VKGK 912 Score = 27.9 bits (59), Expect = 9.4 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +2 Query: 524 QTGSGKTLAYILPAIVHINNQPP 592 QTGSGKT A+++P + I + P Sbjct: 920 QTGSGKTAAFLIPILSRIYMEGP 942 >SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) Length = 490 Score = 30.7 bits (66), Expect = 1.3 Identities = 29/118 (24%), Positives = 52/118 (44%), Gaps = 5/118 (4%) Frame = +1 Query: 349 HEVTVSGVEVHNPI---QYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGK--I* 513 HEV V + +P+ + FEE +++GV MG+ +P+ IQ P+ ++ Sbjct: 86 HEVEVLRSDPSSPLYSAKSFEELPLSANLRRGVYDMGFNKPSKIQETALPMLLADPPVNM 145 Query: 514 LAYSNGFRQNVGLHLASHCAHKQPTAYSER*WSDCLVLAPTRELAQQIQQVAADFWTH 687 +A S + + + T + + + L+PT ELA+Q +VA H Sbjct: 146 IAQSQSGTGKTAAFVLTMLSRVDAT----KPYPQVICLSPTYELARQTGKVAEAMGKH 199 >SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1448 Score = 30.3 bits (65), Expect = 1.8 Identities = 22/86 (25%), Positives = 35/86 (40%) Frame = +1 Query: 430 QGVKTMGYKEPTPIQAQGWPIAMSGKI*LAYSNGFRQNVGLHLASHCAHKQPTAYSER*W 609 QG+K MG+ T IQ + + G+ L + L + R Sbjct: 585 QGIKDMGFTTMTEIQHKSIAPLLKGRDLLGAAKTGSGKTLAFLVPVVELLYKLQFKTRNG 644 Query: 610 SDCLVLAPTRELAQQIQQVAADFWTH 687 + ++++PTREL+ Q VA D H Sbjct: 645 TGVIIISPTRELSLQTYGVARDLLKH 670 >SB_6554| Best HMM Match : Isy1 (HMM E-Value=0) Length = 675 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 2/49 (4%) Frame = +1 Query: 283 FYDPHPTVLKRSPYEVEEYKNN--HEVTVSGVEVHNPIQYFEEANFPDY 423 + D VL E EE NN H++ + + +HNP YFE+ + DY Sbjct: 217 YRDEDDGVLVPIEQEAEEEVNNKLHKILIVNM-IHNPFNYFEKKSPTDY 264 >SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) Length = 978 Score = 29.9 bits (64), Expect = 2.3 Identities = 15/27 (55%), Positives = 18/27 (66%) Frame = +2 Query: 524 QTGSGKTLAYILPAIVHINNQPPIRRG 604 QTGSGKTLAY+ P +VH + R G Sbjct: 423 QTGSGKTLAYLAP-LVHRLREDEERHG 448 >SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069) Length = 120 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = +1 Query: 619 LVLAPTRELAQQIQQV 666 LVL+PTRELA QIQ+V Sbjct: 7 LVLSPTRELANQIQKV 22 >SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 370 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = +1 Query: 619 LVLAPTRELAQQIQQV 666 LVL+PTRELA QIQ+V Sbjct: 69 LVLSPTRELANQIQKV 84 >SB_26138| Best HMM Match : RhoGEF (HMM E-Value=0.0011) Length = 1199 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +2 Query: 227 QNMRRPDWDLFHSNLSTKTFMIHILQFSKD 316 +N RR WD FHSN+S + H+ F D Sbjct: 768 RNKRR--WDSFHSNVSADSGSAHMFDFDTD 795 >SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 697 Score = 29.1 bits (62), Expect = 4.1 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +2 Query: 524 QTGSGKTLAYILPAIVHI 577 +TGSGKTLA+ +P I HI Sbjct: 176 ETGSGKTLAFGIPIIQHI 193 >SB_19782| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 728 Score = 27.9 bits (59), Expect = 9.4 Identities = 12/30 (40%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = -2 Query: 233 CSDLQRILFSHQILQILQIYCHRC-QIETN 147 CS +L +IL+ +YC +C Q ETN Sbjct: 14 CSLCSEVLTEPKILRCFHVYCQKCLQAETN 43 >SB_8125| Best HMM Match : MFS_1 (HMM E-Value=3.2e-07) Length = 401 Score = 27.9 bits (59), Expect = 9.4 Identities = 12/28 (42%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = -2 Query: 164 CQIETNYRRICCLLQIWN-HRFHGYYSS 84 C + +YRR CC L +W H + Y+SS Sbjct: 218 CCVRVDYRRKCC-LHVWRVHTTNTYWSS 244 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,338,296 Number of Sequences: 59808 Number of extensions: 470040 Number of successful extensions: 1186 Number of sequences better than 10.0: 27 Number of HSP's better than 10.0 without gapping: 1087 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1175 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2046258890 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -