BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021161 (753 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein ... 46 1e-06 EF519370-1|ABP68479.1| 452|Anopheles gambiae LRIM1 protein. 26 1.1 AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcript... 25 1.9 X87410-1|CAA60857.1| 498|Anopheles gambiae maltase-like protein... 24 5.8 CR954257-11|CAJ14162.1| 415|Anopheles gambiae predicted protein... 24 5.8 >AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein protein. Length = 596 Score = 46.0 bits (104), Expect = 1e-06 Identities = 32/112 (28%), Positives = 52/112 (46%), Gaps = 3/112 (2%) Frame = +1 Query: 352 EVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKI*LAYS-- 525 +V VSG + ++ FE + + V V+ Y +PTPIQ PI ++G+ +A + Sbjct: 161 QVRVSGENPPDHVESFERSGLREEVMTNVRKSSYTKPTPIQRYAIPIILNGRDLMACAQT 220 Query: 526 -NGFRQNVGLHLASHCAHKQPTAYSER*WSDCLVLAPTRELAQQIQQVAADF 678 +G L + H K+ + +++APTRELA QI F Sbjct: 221 GSGKTAAFMLPMIHHLLDKEDSLELRTRNPYIVIVAPTRELAIQIHDEGRKF 272 >EF519370-1|ABP68479.1| 452|Anopheles gambiae LRIM1 protein. Length = 452 Score = 26.2 bits (55), Expect = 1.1 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = +3 Query: 105 TVVPNLEEATNSAIIRLDLATVAVDLEDLEDLVGKKNSLE 224 T++ +L+E S + LDL +D +L +L +SLE Sbjct: 140 TMLRDLDEGCRSRVQYLDLKLNEIDTVNLAELAASSDSLE 179 >AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcriptase protein. Length = 988 Score = 25.4 bits (53), Expect = 1.9 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 7/45 (15%) Frame = -2 Query: 281 FLLKGWSETNPNL---GDACSDLQRILF----SHQILQILQIYCH 168 F+ KG E +PN GDA D++ +LF S +I +Q CH Sbjct: 926 FVEKGILEGSPNCPECGDAVEDVEHVLFHCPRSDRIRNEMQQRCH 970 >X87410-1|CAA60857.1| 498|Anopheles gambiae maltase-like protein Agm1 protein. Length = 498 Score = 23.8 bits (49), Expect = 5.8 Identities = 9/33 (27%), Positives = 18/33 (54%) Frame = +2 Query: 512 SWRTQTGSGKTLAYILPAIVHINNQPPIRRGDG 610 +++ Q + ++ I A+V + Q +RR DG Sbjct: 460 NYKAQKAAARSHVKIFKALVRLRKQRTLRRNDG 492 >CR954257-11|CAJ14162.1| 415|Anopheles gambiae predicted protein protein. Length = 415 Score = 23.8 bits (49), Expect = 5.8 Identities = 16/70 (22%), Positives = 26/70 (37%) Frame = +1 Query: 226 SEHASPRLGFVSLQPFNKNFYDPHPTVLKRSPYEVEEYKNNHEVTVSGVEVHNPIQYFEE 405 SE + +++P Y+P P VL + V E + ++ + V EE Sbjct: 97 SEDVESSIPVSTIEPNLVEVYEPPPVVLIDTGNNVVEVNTDDQIVLEDGSVEGESNEQEE 156 Query: 406 ANFPDYVQQG 435 A Y G Sbjct: 157 AQIDVYHVDG 166 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 752,956 Number of Sequences: 2352 Number of extensions: 15366 Number of successful extensions: 39 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 36 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 37 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 77755161 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -