BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021161 (753 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 53 3e-09 DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 23 2.3 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 23 2.3 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 23 2.3 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 23 2.3 AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 23 2.3 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 21 9.4 DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 21 9.4 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 21 9.4 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 21 9.4 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 52.8 bits (121), Expect = 3e-09 Identities = 35/117 (29%), Positives = 57/117 (48%), Gaps = 5/117 (4%) Frame = +1 Query: 343 NNHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKI*LAY 522 +N +V VSG V PI+ FE A + V +K GYK+PTP+Q PI M+G+ +A Sbjct: 180 DNIQVNVSGDNVPQPIESFEAAGLRNIVLDNIKKSGYKKPTPVQKHALPIIMNGRDLMAC 239 Query: 523 S---NGFRQNVGLHLASHCAHKQPTAYSER*WSD--CLVLAPTRELAQQIQQVAADF 678 + +G + + + + + + ++++PTREL QI Q F Sbjct: 240 AQTGSGKTAAFAVPIINTLLERSVDLVVTSTYCEPQVVIVSPTRELTIQIWQQIVKF 296 Score = 25.0 bits (52), Expect = 0.76 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = +2 Query: 524 QTGSGKTLAYILPAI 568 QTGSGKT A+ +P I Sbjct: 241 QTGSGKTAAFAVPII 255 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 23.4 bits (48), Expect = 2.3 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = +3 Query: 462 DAYSSSRLADSYVWKDLVGVLKRVPA 539 ++ S + A +YVWK+ G L++ P+ Sbjct: 205 ESISYEQTAITYVWKNDEGTLRKSPS 230 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 23.4 bits (48), Expect = 2.3 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = +3 Query: 462 DAYSSSRLADSYVWKDLVGVLKRVPA 539 ++ S + A +YVWK+ G L++ P+ Sbjct: 205 ESISYEQTAITYVWKNDEGTLRKSPS 230 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 23.4 bits (48), Expect = 2.3 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = +3 Query: 462 DAYSSSRLADSYVWKDLVGVLKRVPA 539 ++ S + A +YVWK+ G L++ P+ Sbjct: 256 ESISYEQTAITYVWKNDEGTLRKSPS 281 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 23.4 bits (48), Expect = 2.3 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = +3 Query: 462 DAYSSSRLADSYVWKDLVGVLKRVPA 539 ++ S + A +YVWK+ G L++ P+ Sbjct: 205 ESISYEQTAITYVWKNDEGTLRKSPS 230 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 23.4 bits (48), Expect = 2.3 Identities = 12/41 (29%), Positives = 20/41 (48%) Frame = -3 Query: 679 KNLQQLAEFVVLTLW*APRPSNRTITSPNRRLVVYVHNGWQ 557 K++Q++ + +W R N T PN L V+ + WQ Sbjct: 134 KSVQRIKPYDEYYVWRDARIVNGTRQPPNNWLSVFWGSAWQ 174 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 21.4 bits (43), Expect = 9.4 Identities = 6/16 (37%), Positives = 8/16 (50%) Frame = -3 Query: 250 PIWATHVLTSREFFFP 203 P+W H+ R FP Sbjct: 634 PVWGRHIYDGRAMGFP 649 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 21.4 bits (43), Expect = 9.4 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -2 Query: 608 HHLSE*AVGCLCAQWLARCRPTFCRNPFEYA 516 +++SE V L + +PT N FEYA Sbjct: 180 NYMSELTVDILLETAMGVSKPTRDHNAFEYA 210 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 21.4 bits (43), Expect = 9.4 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +3 Query: 84 TGIIAVETVVPNLEEATNSA 143 T + A V P +EE TN+A Sbjct: 412 TALGAAALVAPGMEEPTNTA 431 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 21.4 bits (43), Expect = 9.4 Identities = 6/16 (37%), Positives = 8/16 (50%) Frame = -3 Query: 250 PIWATHVLTSREFFFP 203 P+W H+ R FP Sbjct: 634 PVWGRHIYDGRAMGFP 649 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 198,808 Number of Sequences: 438 Number of extensions: 4248 Number of successful extensions: 14 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23632110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -