BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021160 (635 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC033712-1|AAH33712.1| 415|Homo sapiens TBC1D2B protein protein. 31 4.5 AK000173-1|BAA90990.1| 312|Homo sapiens protein ( Homo sapiens ... 31 4.5 AB028978-1|BAA83007.1| 868|Homo sapiens KIAA1055 protein protein. 31 4.5 >BC033712-1|AAH33712.1| 415|Homo sapiens TBC1D2B protein protein. Length = 415 Score = 30.7 bits (66), Expect = 4.5 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +3 Query: 33 LSDQILKRNQVTNGFRVDLLKTSNSTKHYPCPS 131 L + K+N + +DLL+T + KHY CP+ Sbjct: 148 LQKALEKQNPASKQIELDLLRTLPNNKHYSCPT 180 >AK000173-1|BAA90990.1| 312|Homo sapiens protein ( Homo sapiens cDNA FLJ20166 fis, clone COL09511. ). Length = 312 Score = 30.7 bits (66), Expect = 4.5 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +3 Query: 33 LSDQILKRNQVTNGFRVDLLKTSNSTKHYPCPS 131 L + K+N + +DLL+T + KHY CP+ Sbjct: 148 LQKALEKQNPASKQIELDLLRTLPNNKHYSCPT 180 >AB028978-1|BAA83007.1| 868|Homo sapiens KIAA1055 protein protein. Length = 868 Score = 30.7 bits (66), Expect = 4.5 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +3 Query: 33 LSDQILKRNQVTNGFRVDLLKTSNSTKHYPCPS 131 L + K+N + +DLL+T + KHY CP+ Sbjct: 650 LQKALEKQNPASKQIELDLLRTLPNNKHYSCPT 682 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 72,985,762 Number of Sequences: 237096 Number of extensions: 1299591 Number of successful extensions: 1796 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1780 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1796 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6972732040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -