BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021159 (680 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ005422-1|CAA06528.1| 287|Tribolium castaneum caudal protein p... 25 0.57 AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment h... 24 1.0 X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. 24 1.3 AJ005421-1|CAA06527.1| 249|Tribolium castaneum caudal protein p... 24 1.3 AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. 24 1.3 AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain tran... 23 1.8 AF231104-1|AAF64149.1| 142|Tribolium castaneum labial protein p... 23 1.8 AF231103-1|AAF64148.1| 142|Tribolium castaneum labial protein p... 23 1.8 AF452568-1|AAL57830.1| 243|Tribolium castaneum homeodomain tran... 23 2.3 AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. 23 2.3 S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Triboliu... 23 3.1 AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neu... 22 4.0 AM292360-1|CAL23172.2| 427|Tribolium castaneum gustatory recept... 22 4.0 AM292331-1|CAL23143.2| 437|Tribolium castaneum gustatory recept... 22 4.0 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 22 4.0 U14732-1|AAC46491.1| 322|Tribolium castaneum fushi-tarazu protein. 21 7.1 AY695256-1|AAW21973.1| 168|Tribolium castaneum ventral nerve co... 21 7.1 AY043292-2|AAK96032.1| 290|Tribolium castaneum homeodomain tran... 21 7.1 AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 21 7.1 AF321227-1|AAK16421.1| 290|Tribolium castaneum Ftz protein. 21 7.1 U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. 21 9.3 U81038-1|AAB39355.1| 412|Tribolium castaneum transcription fact... 21 9.3 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 21 9.3 AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain tran... 21 9.3 AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. 21 9.3 AF187068-1|AAF03888.1| 477|Tribolium castaneum proboscipedia or... 21 9.3 >AJ005422-1|CAA06528.1| 287|Tribolium castaneum caudal protein protein. Length = 287 Score = 25.0 bits (52), Expect = 0.57 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +1 Query: 85 VSKYASQ*EEHNRENRLEISESERKLWFKN 174 VSKY + + L +SE + K+WF+N Sbjct: 178 VSKYITIKRKSELAENLGLSERQIKIWFQN 207 >AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment homeodomain protein protein. Length = 232 Score = 24.2 bits (50), Expect = 1.0 Identities = 13/48 (27%), Positives = 21/48 (43%) Frame = +1 Query: 31 PQLKITKNGFFARRYKCVVSKYASQ*EEHNRENRLEISESERKLWFKN 174 P+ T A K +Y S E + L ++E + K+WF+N Sbjct: 118 PRTPFTTQQLLALEKKFRDKQYLSIAERAEFSSSLRLTEPQVKIWFQN 165 >X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. Length = 251 Score = 23.8 bits (49), Expect = 1.3 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = +1 Query: 91 KYASQ*EEHNRENRLEISESERKLWFKN 174 KY S+ L +SE + K+WF+N Sbjct: 111 KYLSRPRRIQIAENLNLSERQIKIWFQN 138 >AJ005421-1|CAA06527.1| 249|Tribolium castaneum caudal protein protein. Length = 249 Score = 23.8 bits (49), Expect = 1.3 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = +1 Query: 88 SKYASQ*EEHNRENRLEISESERKLWFKN 174 S+Y + + N L +SE + K+WF+N Sbjct: 178 SRYITIRRKAELANSLGLSERQVKIWFQN 206 >AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. Length = 246 Score = 23.8 bits (49), Expect = 1.3 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = +1 Query: 91 KYASQ*EEHNRENRLEISESERKLWFKN 174 KY S+ L +SE + K+WF+N Sbjct: 102 KYLSRPRRIQIAENLNLSERQIKIWFQN 129 >AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain transcription factor Labialprotein. Length = 353 Score = 23.4 bits (48), Expect = 1.8 Identities = 8/29 (27%), Positives = 19/29 (65%) Frame = +1 Query: 88 SKYASQ*EEHNRENRLEISESERKLWFKN 174 +KY ++ + L+++E++ K+WF+N Sbjct: 275 NKYLTRARRIEIASALQLNETQVKIWFQN 303 >AF231104-1|AAF64149.1| 142|Tribolium castaneum labial protein protein. Length = 142 Score = 23.4 bits (48), Expect = 1.8 Identities = 8/29 (27%), Positives = 19/29 (65%) Frame = +1 Query: 88 SKYASQ*EEHNRENRLEISESERKLWFKN 174 +KY ++ + L+++E++ K+WF+N Sbjct: 64 NKYLTRARRIEIASALQLNETQVKIWFQN 92 >AF231103-1|AAF64148.1| 142|Tribolium castaneum labial protein protein. Length = 142 Score = 23.4 bits (48), Expect = 1.8 Identities = 8/29 (27%), Positives = 19/29 (65%) Frame = +1 Query: 88 SKYASQ*EEHNRENRLEISESERKLWFKN 174 +KY ++ + L+++E++ K+WF+N Sbjct: 64 NKYLTRARRIEIASALQLNETQVKIWFQN 92 >AF452568-1|AAL57830.1| 243|Tribolium castaneum homeodomain transcription factor Zen2 protein. Length = 243 Score = 23.0 bits (47), Expect = 2.3 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = +1 Query: 88 SKYASQ*EEHNRENRLEISESERKLWFKN 174 SKY + L ++E + K+WF+N Sbjct: 107 SKYLCRPRRIQMAQNLNLTERQIKIWFQN 135 >AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. Length = 292 Score = 23.0 bits (47), Expect = 2.3 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = +1 Query: 88 SKYASQ*EEHNRENRLEISESERKLWFKN 174 SKY + L ++E + K+WF+N Sbjct: 127 SKYLCRPRRIQMAQNLNLTERQIKIWFQN 155 >S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Tribolium castaneum homeodomainprotein mRNA, complete cds. ). Length = 327 Score = 22.6 bits (46), Expect = 3.1 Identities = 7/35 (20%), Positives = 20/35 (57%) Frame = +1 Query: 70 RYKCVVSKYASQ*EEHNRENRLEISESERKLWFKN 174 +++ ++Y ++ L ++E++ K+WF+N Sbjct: 244 KHEFAENRYLTERRRQQLSAELGLNEAQIKIWFQN 278 >AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neuroblasts defectiveprotein protein. Length = 224 Score = 22.2 bits (45), Expect = 4.0 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = +1 Query: 133 LEISESERKLWFKN 174 L +SE + K+WF+N Sbjct: 154 LRLSEKQVKIWFQN 167 >AM292360-1|CAL23172.2| 427|Tribolium castaneum gustatory receptor candidate 39 protein. Length = 427 Score = 22.2 bits (45), Expect = 4.0 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +2 Query: 485 FENLWCHFQLK 517 F+N+W FQLK Sbjct: 150 FKNMWTRFQLK 160 >AM292331-1|CAL23143.2| 437|Tribolium castaneum gustatory receptor candidate 10 protein. Length = 437 Score = 22.2 bits (45), Expect = 4.0 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +2 Query: 485 FENLWCHFQLK 517 F+N+W FQLK Sbjct: 150 FKNMWTRFQLK 160 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 22.2 bits (45), Expect = 4.0 Identities = 8/27 (29%), Positives = 15/27 (55%) Frame = +1 Query: 94 YASQ*EEHNRENRLEISESERKLWFKN 174 Y S+ + L ++E + K+WF+N Sbjct: 267 YVSKQKRWELARNLNLTERQVKIWFQN 293 >U14732-1|AAC46491.1| 322|Tribolium castaneum fushi-tarazu protein. Length = 322 Score = 21.4 bits (43), Expect = 7.1 Identities = 11/24 (45%), Positives = 15/24 (62%), Gaps = 6/24 (25%) Frame = +1 Query: 121 RENRLEISESER------KLWFKN 174 R R+EI+ES R K+WF+N Sbjct: 210 RRRRIEIAESLRLTERQIKIWFQN 233 >AY695256-1|AAW21973.1| 168|Tribolium castaneum ventral nerve cord defective protein protein. Length = 168 Score = 21.4 bits (43), Expect = 7.1 Identities = 7/28 (25%), Positives = 17/28 (60%) Frame = +1 Query: 91 KYASQ*EEHNRENRLEISESERKLWFKN 174 +Y S E + + + ++ ++ K+WF+N Sbjct: 63 RYLSAPEREHLASIIRLTPTQVKIWFQN 90 >AY043292-2|AAK96032.1| 290|Tribolium castaneum homeodomain transcription factor Fushitarazu protein. Length = 290 Score = 21.4 bits (43), Expect = 7.1 Identities = 11/24 (45%), Positives = 15/24 (62%), Gaps = 6/24 (25%) Frame = +1 Query: 121 RENRLEISESER------KLWFKN 174 R R+EI+ES R K+WF+N Sbjct: 210 RRRRIEIAESLRLTERQIKIWFQN 233 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 21.4 bits (43), Expect = 7.1 Identities = 15/46 (32%), Positives = 20/46 (43%) Frame = +2 Query: 308 PV*SGISENHVLPRSTPRTPGQACGTPIEAS*QGESFDTWFIEIRQ 445 P+ + I E L TPR PG A G + E + +IRQ Sbjct: 87 PLLALIFEKCELATCTPREPGVAGGDVCSSESFNEDIAVFSKQIRQ 132 >AF321227-1|AAK16421.1| 290|Tribolium castaneum Ftz protein. Length = 290 Score = 21.4 bits (43), Expect = 7.1 Identities = 11/24 (45%), Positives = 15/24 (62%), Gaps = 6/24 (25%) Frame = +1 Query: 121 RENRLEISESER------KLWFKN 174 R R+EI+ES R K+WF+N Sbjct: 210 RRRRIEIAESLRLTERQIKIWFQN 233 >U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. Length = 283 Score = 21.0 bits (42), Expect = 9.3 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = +1 Query: 133 LEISESERKLWFKN 174 L +SE + K+WF+N Sbjct: 270 LVLSERQIKIWFQN 283 >U81038-1|AAB39355.1| 412|Tribolium castaneum transcription factor Deformed protein. Length = 412 Score = 21.0 bits (42), Expect = 9.3 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = +1 Query: 133 LEISESERKLWFKN 174 L +SE + K+WF+N Sbjct: 270 LVLSERQIKIWFQN 283 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 21.0 bits (42), Expect = 9.3 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = -1 Query: 332 FQKFRITLAVFHRKNPGYS 276 F ++R TLA++ NP Y+ Sbjct: 653 FPRWRQTLAMWLNHNPNYA 671 >AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain transcription factor Maxillopediaprotein. Length = 523 Score = 21.0 bits (42), Expect = 9.3 Identities = 6/14 (42%), Positives = 12/14 (85%) Frame = +1 Query: 133 LEISESERKLWFKN 174 L+++E + K+WF+N Sbjct: 41 LDLTERQVKVWFQN 54 >AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. Length = 412 Score = 21.0 bits (42), Expect = 9.3 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = +1 Query: 133 LEISESERKLWFKN 174 L +SE + K+WF+N Sbjct: 270 LVLSERQIKIWFQN 283 >AF187068-1|AAF03888.1| 477|Tribolium castaneum proboscipedia ortholog protein. Length = 477 Score = 21.0 bits (42), Expect = 9.3 Identities = 6/14 (42%), Positives = 12/14 (85%) Frame = +1 Query: 133 LEISESERKLWFKN 174 L+++E + K+WF+N Sbjct: 172 LDLTERQVKVWFQN 185 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,946 Number of Sequences: 336 Number of extensions: 3630 Number of successful extensions: 31 Number of sequences better than 10.0: 26 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17801955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -