BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021159 (680 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein pr... 26 1.3 AF269153-1|AAF91398.1| 109|Anopheles gambiae labial homeotic pr... 25 2.9 AJ439353-4|CAD27926.1| 338|Anopheles gambiae putative hox prote... 24 3.9 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 23 6.7 >AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein protein. Length = 476 Score = 25.8 bits (54), Expect = 1.3 Identities = 15/51 (29%), Positives = 24/51 (47%), Gaps = 3/51 (5%) Frame = +3 Query: 330 KTTCYRDRLPGHLDRRVAHQ*KRLDKANLLTPGSSRSDN---PGQHSEALK 473 K TC+R R PGH+ R + + + S +++N G E+LK Sbjct: 201 KITCHRCRKPGHMKRDCPMESNNTPTSTTMRDYSRKNENCSSSGGQRESLK 251 >AF269153-1|AAF91398.1| 109|Anopheles gambiae labial homeotic protein protein. Length = 109 Score = 24.6 bits (51), Expect = 2.9 Identities = 9/29 (31%), Positives = 18/29 (62%) Frame = +1 Query: 88 SKYASQ*EEHNRENRLEISESERKLWFKN 174 +KY ++ N L ++E++ K+WF+N Sbjct: 75 NKYLTRARRIEIANALHLNETQVKIWFQN 103 >AJ439353-4|CAD27926.1| 338|Anopheles gambiae putative hox protein protein. Length = 338 Score = 24.2 bits (50), Expect = 3.9 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = +1 Query: 130 RLEISESERKLWFKN 174 RL +SE + K+WF+N Sbjct: 232 RLRLSEKQVKIWFQN 246 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 23.4 bits (48), Expect = 6.7 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = -1 Query: 551 NKKIKKGGCRFTLAENDTKDFQNFVD 474 N KI KGG TLA +D + +D Sbjct: 1131 NHKISKGGYNATLANGKIQDARRQLD 1156 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 716,945 Number of Sequences: 2352 Number of extensions: 14316 Number of successful extensions: 29 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68577420 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -