BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021149 (813 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC794.08 |||HEAT repeat protein, unknown biological role|Schiz... 29 0.79 SPBC1A4.07c |||U3 snoRNP-associated protein Sof1|Schizosaccharom... 27 4.2 SPCC1183.05c |lig4||DNA ligase Lig4|Schizosaccharomyces pombe|ch... 25 9.7 >SPCC794.08 |||HEAT repeat protein, unknown biological role|Schizosaccharomyces pombe|chr 3|||Manual Length = 798 Score = 29.1 bits (62), Expect = 0.79 Identities = 16/50 (32%), Positives = 26/50 (52%) Frame = -1 Query: 501 NSKAHGPSRSKTFLSLARLRSNHYRLVKCSSTRLETNRPDHIELGVRIDI 352 NS + K+F+ L R + Y+ + SST + + P+H E G ID+ Sbjct: 199 NSWSESDQEKKSFIDLVRSTAKSYKPLPPSSTGV--SLPEHDEAGDNIDV 246 >SPBC1A4.07c |||U3 snoRNP-associated protein Sof1|Schizosaccharomyces pombe|chr 2|||Manual Length = 436 Score = 26.6 bits (56), Expect = 4.2 Identities = 16/41 (39%), Positives = 21/41 (51%) Frame = +2 Query: 35 EIQRIKREIHSQSVERGVSECCRLEQAYTKRREQLARDHEK 157 EI+RI R H + + +E R E KRRE+ R H K Sbjct: 377 EIRRIARHRHLPTNVKKAAEIKREEINSLKRREENIRRHSK 417 >SPCC1183.05c |lig4||DNA ligase Lig4|Schizosaccharomyces pombe|chr 3|||Manual Length = 923 Score = 25.4 bits (53), Expect = 9.7 Identities = 10/48 (20%), Positives = 23/48 (47%) Frame = +3 Query: 495 YCLSMFDSSPPHVAGSSPYISWHEMLSSIMLHSTIREIFLSAM*TSAY 638 Y + FD + ++W +L +++ + ++R IF + S+Y Sbjct: 338 YIIGAFDKRISQIILDGEMVTWDPVLETVIPYGSLRSIFEDSSSHSSY 385 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,534,960 Number of Sequences: 5004 Number of extensions: 42842 Number of successful extensions: 134 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 132 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 134 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 396433620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -