BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021148 (725 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF079312-1|AAC28093.1| 271|Anopheles gambiae 60S ribosomal prot... 24 5.5 U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 23 7.3 DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domai... 23 7.3 X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. 23 9.6 EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc... 23 9.6 >AF079312-1|AAC28093.1| 271|Anopheles gambiae 60S ribosomal protein rpL7a protein. Length = 271 Score = 23.8 bits (49), Expect = 5.5 Identities = 15/43 (34%), Positives = 19/43 (44%) Frame = -3 Query: 150 SKSPEKLTLNFNSFCGSIVSTWLGILLYYKHSISLAKFNRLRK 22 +K E + NFN I W G LL K LAK + +K Sbjct: 222 AKLVETIKTNFNDRFDDIRRHWGGGLLGPKSMARLAKLEKAKK 264 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 23.4 bits (48), Expect = 7.3 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = -1 Query: 278 FEFGARTPNWDARNISLVLLF*S*IALYRLSGSL 177 F+ A T W NI LLF + ++YR SL Sbjct: 106 FDLIALTETWLVDNIPSALLFNNNFSVYRCDRSL 139 >DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domain protein protein. Length = 285 Score = 23.4 bits (48), Expect = 7.3 Identities = 8/23 (34%), Positives = 11/23 (47%) Frame = +3 Query: 24 FSIC*ILPTRYCAYSTIKCLTKC 92 +S C P + C +KC T C Sbjct: 32 YSCCAPCPQKACISEAVKCQTSC 54 >X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. Length = 1231 Score = 23.0 bits (47), Expect = 9.6 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = +1 Query: 154 WLHNLHETNEPDKRYSAIQDQNNS 225 W H+ E N+P RY+ + ++S Sbjct: 691 WDHSNMEVNKPKNRYANVTSYDHS 714 >EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium channel alpha2-delta subunit 1 protein. Length = 1256 Score = 23.0 bits (47), Expect = 9.6 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +1 Query: 286 IAITPQPVYLDPNENHKH 339 +AI P PV DP+E+ H Sbjct: 30 LAIDPTPVSADPDEDIPH 47 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 746,062 Number of Sequences: 2352 Number of extensions: 15103 Number of successful extensions: 24 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74012934 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -