BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021139 (848 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC16C4.02c |||DUF1941 family protein|Schizosaccharomyces pombe... 27 3.4 SPCC622.21 |wtf12||wtf element Wtf12|Schizosaccharomyces pombe|c... 26 7.8 >SPCC16C4.02c |||DUF1941 family protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 548 Score = 27.1 bits (57), Expect = 3.4 Identities = 12/45 (26%), Positives = 27/45 (60%) Frame = +2 Query: 287 YVVHYSDLIVNKFP*FGRPVFQLINHKLRVVKNSNNFKNYIHPYF 421 Y+++Y+ I+N+FP F+++++ L + +N + Y+ P F Sbjct: 179 YLLYYTSFIINEFP--FEQAFEILSNALYAL---DNVQTYMRPIF 218 >SPCC622.21 |wtf12||wtf element Wtf12|Schizosaccharomyces pombe|chr 3|||Manual Length = 197 Score = 25.8 bits (54), Expect = 7.8 Identities = 17/43 (39%), Positives = 23/43 (53%), Gaps = 2/43 (4%) Frame = -3 Query: 546 SIYQLLRIFVDSLRLSVFYFLTTQI--*LVKDT*RPVKFFVLI 424 +IY LLR+ + L +SV +F L K T + FFVLI Sbjct: 83 NIYSLLRLLIAVLAVSVVFFTAWGCVNPLEKSTFGKIAFFVLI 125 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,129,919 Number of Sequences: 5004 Number of extensions: 59060 Number of successful extensions: 124 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 118 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 124 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 420459900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -