BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021134 (733 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g02870.1 68418.m00230 60S ribosomal protein L4/L1 (RPL4D) 60S... 112 3e-25 At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) str... 112 3e-25 At1g57750.1 68414.m06552 cytochrome P450, putative similar to cy... 31 0.79 At1g26400.1 68414.m03220 FAD-binding domain-containing protein s... 30 1.8 At5g55100.2 68418.m06869 SWAP (Suppressor-of-White-APricot)/surp... 29 3.2 At5g55100.1 68418.m06868 SWAP (Suppressor-of-White-APricot)/surp... 29 3.2 At4g39480.1 68417.m05585 cytochrome P450 family protein contains... 29 3.2 At2g05520.1 68415.m00584 glycine-rich protein (GRP) identical to... 29 4.2 At5g17650.1 68418.m02069 glycine/proline-rich protein glycine/pr... 28 7.3 At3g12430.1 68416.m01548 expressed protein ; expression supporte... 28 7.3 At5g07520.1 68418.m00861 glycine-rich protein (GRP18) Oleosin; g... 27 9.7 At4g29230.1 68417.m04181 no apical meristem (NAM) family protein... 27 9.7 At1g80480.1 68414.m09427 PRLI-interacting factor L, putative sim... 27 9.7 At1g49740.1 68414.m05578 expressed protein similar to MAP3K-like... 27 9.7 >At5g02870.1 68418.m00230 60S ribosomal protein L4/L1 (RPL4D) 60S roibosomal protein L4, Arabidopsis thaliana, EMBL:CAA79104 Length = 407 Score = 112 bits (269), Expect = 3e-25 Identities = 47/53 (88%), Positives = 50/53 (94%) Frame = +2 Query: 254 YQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRRWH 412 +QTSAESWGTGRAV+RIPRV GGGTHR+GQ AFGNMCRGGRMFAPTK WRRWH Sbjct: 66 HQTSAESWGTGRAVSRIPRVPGGGTHRAGQAAFGNMCRGGRMFAPTKIWRRWH 118 Score = 73.3 bits (172), Expect = 1e-13 Identities = 32/68 (47%), Positives = 46/68 (67%) Frame = +3 Query: 513 IPELPLVVADKVQEINKTKQAVIFLRRLKAWSDILKVYKSHRLRAGKGKMRNRRRIQRKG 692 +PE+PLVV+D + + KT A+ L+++ A+ D K S +R GKGKMRNRR I RKG Sbjct: 153 VPEMPLVVSDSAEAVEKTSAAIKVLKQIGAYDDAEKAKNSIGIRPGKGKMRNRRYISRKG 212 Query: 693 PLIIFNKD 716 PL++F + Sbjct: 213 PLVVFGTE 220 Score = 62.5 bits (145), Expect = 3e-10 Identities = 32/61 (52%), Positives = 39/61 (63%), Gaps = 2/61 (3%) Frame = +3 Query: 78 SVARPLVSVYSEKSE--TVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSKEA 251 + ARPLV+V + T Q LP V AP+RPD+VN VH +S NSRQPY VSK+A Sbjct: 5 AAARPLVTVQGLDGDMSTDQSTTVTLPDVMTAPVRPDIVNFVHAQISNNSRQPYAVSKKA 64 Query: 252 G 254 G Sbjct: 65 G 65 Score = 37.1 bits (82), Expect = 0.012 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +1 Query: 454 SVAATGVPALVQARGHIIERFPSFP 528 ++AAT VPALV ARGH IE P P Sbjct: 133 AIAATAVPALVMARGHKIENVPEMP 157 >At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) strong similarity to 60S ribosomal protein L1 GB:P49691 Length = 406 Score = 112 bits (269), Expect = 3e-25 Identities = 47/53 (88%), Positives = 50/53 (94%) Frame = +2 Query: 254 YQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRRWH 412 +QTSAESWGTGRAV+RIPRV GGGTHR+GQ AFGNMCRGGRMFAPTK WRRWH Sbjct: 65 HQTSAESWGTGRAVSRIPRVPGGGTHRAGQAAFGNMCRGGRMFAPTKIWRRWH 117 Score = 72.1 bits (169), Expect = 3e-13 Identities = 31/68 (45%), Positives = 46/68 (67%) Frame = +3 Query: 513 IPELPLVVADKVQEINKTKQAVIFLRRLKAWSDILKVYKSHRLRAGKGKMRNRRRIQRKG 692 +PE+PLVV+D + + KT A+ L+++ A+ D K S +R GKGKMRNRR I RKG Sbjct: 152 VPEMPLVVSDSAEAVEKTSAAIKVLKQIGAYDDAEKAKNSIGIRPGKGKMRNRRYISRKG 211 Query: 693 PLIIFNKD 716 PL+++ + Sbjct: 212 PLVVYGTE 219 Score = 64.5 bits (150), Expect = 7e-11 Identities = 32/64 (50%), Positives = 43/64 (67%), Gaps = 2/64 (3%) Frame = +3 Query: 69 MSLSVARPLVSVYSEKSE--TVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVS 242 M+ + ARPLV++ + + T Q + LP V AP+RPD+VN VH +S NSRQPY VS Sbjct: 1 MAAAAARPLVTIQTLDGDMSTDQSSTVVLPDVMTAPVRPDIVNFVHAQISNNSRQPYAVS 60 Query: 243 KEAG 254 K+AG Sbjct: 61 KKAG 64 Score = 37.1 bits (82), Expect = 0.012 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +1 Query: 454 SVAATGVPALVQARGHIIERFPSFP 528 ++AAT VPALV ARGH IE P P Sbjct: 132 AIAATAVPALVMARGHKIENVPEMP 156 >At1g57750.1 68414.m06552 cytochrome P450, putative similar to cytochrome P450 GI:4688670 from [Catharanthus roseus] Length = 497 Score = 31.1 bits (67), Expect = 0.79 Identities = 21/70 (30%), Positives = 35/70 (50%) Frame = +3 Query: 93 LVSVYSEKSETVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSKEAGTKPVLN 272 LV +++ SE+++ PLPF K+P +PD++ H + NS+ C+ + V Sbjct: 351 LVYLHAALSESMR-LYPPLPFNHKSPAKPDVLPSGH-KVDANSKIVICIYALGRMRSVWG 408 Query: 273 HGVLDVLSPE 302 LD PE Sbjct: 409 EDALD-FKPE 417 >At1g26400.1 68414.m03220 FAD-binding domain-containing protein similar to SP|P30986 reticuline oxidase precursor (Berberine-bridge-forming enzyme) (BBE) (Tetrahydroprotoberberine synthase) [Eschscholzia californica]; contains PF01565 FAD binding domain Length = 527 Score = 29.9 bits (64), Expect = 1.8 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = -1 Query: 571 CLVLLISWTLSATTKGSSGIFQ*CV 497 CLVLL+S +A TK SGIF C+ Sbjct: 9 CLVLLVSILRAAVTKPDSGIFTGCL 33 >At5g55100.2 68418.m06869 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein contains Pfam domain PF01805: Surp module Length = 844 Score = 29.1 bits (62), Expect = 3.2 Identities = 12/41 (29%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -3 Query: 383 RTYVHHDTCYRRHPDRTY-EYHHHGHAEFGRQHVQYPMIQH 264 R++ H + +H D + E+HHH H R+H ++H Sbjct: 735 RSHHHRSRKHEKHRDSSDDEHHHHRHRSSRRKHEDSSDVEH 775 >At5g55100.1 68418.m06868 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein contains Pfam domain PF01805: Surp module Length = 843 Score = 29.1 bits (62), Expect = 3.2 Identities = 12/41 (29%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -3 Query: 383 RTYVHHDTCYRRHPDRTY-EYHHHGHAEFGRQHVQYPMIQH 264 R++ H + +H D + E+HHH H R+H ++H Sbjct: 735 RSHHHRSRKHEKHRDSSDDEHHHHRHRSSRRKHEDSSDVEH 775 >At4g39480.1 68417.m05585 cytochrome P450 family protein contains Pfam profile: PF00067 cytochrome P450 Length = 989 Score = 29.1 bits (62), Expect = 3.2 Identities = 16/53 (30%), Positives = 26/53 (49%) Frame = +3 Query: 144 PLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSKEAGTKPVLNHGVLDVLSPE 302 P+PF K+P +PD++ H + NSR +C+ K V ++ PE Sbjct: 384 PVPFNHKSPAKPDVLPSGH-KVKANSRILFCLYSLGRMKSVWGEDAME-FKPE 434 Score = 29.1 bits (62), Expect = 3.2 Identities = 16/53 (30%), Positives = 26/53 (49%) Frame = +3 Query: 144 PLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSKEAGTKPVLNHGVLDVLSPE 302 P+PF K+P +PD++ H + NS+ +C+ K V L+ PE Sbjct: 857 PVPFQHKSPTKPDVLPSGH-KVDANSKILFCLYSLGRMKSVWGEDALE-FKPE 907 >At2g05520.1 68415.m00584 glycine-rich protein (GRP) identical to glycine-rich protein; atGRP (GI:259447) [Arabidopsis thaliana] Length = 145 Score = 28.7 bits (61), Expect = 4.2 Identities = 17/45 (37%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = +2 Query: 245 GGWYQTSAESW--GTGRAVARIPRVRGGGTHRSGQGAFGNMCRGG 373 GG YQ + G GR R +GGG + G G+ G+ CR G Sbjct: 75 GGNYQGGGGRYQGGGGRYQGGGGRYQGGGGRQGGGGSGGSYCRHG 119 >At5g17650.1 68418.m02069 glycine/proline-rich protein glycine/proline-rich protein GPRP - Arabidopsis thaliana, EMBL:X84315 Length = 173 Score = 27.9 bits (59), Expect = 7.3 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = -3 Query: 371 HHDTCYRRHPDRTYEYHHHGHAEF 300 HH Y H Y Y +HGH +F Sbjct: 122 HHHGHYGHHHGHGYGYGYHGHGKF 145 >At3g12430.1 68416.m01548 expressed protein ; expression supported by MPSS Length = 238 Score = 27.9 bits (59), Expect = 7.3 Identities = 12/40 (30%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Frame = -2 Query: 147 GAWLHPAPSHSSLNTPTLKVGLPID--SFRYFSEAIPLKY 34 G W+H SH+ ++ L VG+ + Y+S + P++Y Sbjct: 38 GQWIHDVLSHNRFSSHPLVVGVGVQWTPSSYYSASSPVRY 77 >At5g07520.1 68418.m00861 glycine-rich protein (GRP18) Oleosin; glycine-rich protein 18 (GRP18) PMID:11431566; Length = 228 Score = 27.5 bits (58), Expect = 9.7 Identities = 19/64 (29%), Positives = 28/64 (43%), Gaps = 3/64 (4%) Frame = +2 Query: 218 LEAALLREQGGWYQTSAESWGTGRAVARIPRVRGGGTHRSGQ---GAFGNMCRGGRMFAP 388 + AL+R + G T AE + + + ++P G G G+ G FGN GG F Sbjct: 76 MAVALIRRRMGAKPT-AEGTSSAQPLLKLPVYGGYGGFWGGKKFSGTFGNKPGGGNPFGD 134 Query: 389 TKPW 400 W Sbjct: 135 ISKW 138 >At4g29230.1 68417.m04181 no apical meristem (NAM) family protein similar to NAM family proteins GP|12751304|, GP|6223650|, GP|9758909 - Arabidopsis thaliana,PIR2:T04621 Length = 498 Score = 27.5 bits (58), Expect = 9.7 Identities = 17/59 (28%), Positives = 22/59 (37%), Gaps = 4/59 (6%) Frame = -3 Query: 350 RHPDRTYEYHHHGHAEFGRQHVQYPMIQHWFGTSLLAHAVGL---PRV-LGHRNVNIID 186 RH + HH H H Q H F S H + P L H ++NI+D Sbjct: 346 RHQPSSSTSHHMAHDHHHHHHQQQQQRHHAFNISQPTHPISTIISPSTSLHHASINILD 404 >At1g80480.1 68414.m09427 PRLI-interacting factor L, putative similar to PRLI-interacting factor L [Arabidopsis thaliana] GI:11139268; contains Pfam profile PF02492: Cobalamin synthesis protein/P47K Length = 444 Score = 27.5 bits (58), Expect = 9.7 Identities = 9/28 (32%), Positives = 13/28 (46%) Frame = -3 Query: 371 HHDTCYRRHPDRTYEYHHHGHAEFGRQH 288 HHD + H D +++ HH H H Sbjct: 311 HHDHDHDHHHDHNHDHDHHHHDGHDHHH 338 >At1g49740.1 68414.m05578 expressed protein similar to MAP3K-like protein kinase GB:CAB16796 GI:4006878 from [Arabidopsis thaliana] Length = 359 Score = 27.5 bits (58), Expect = 9.7 Identities = 19/57 (33%), Positives = 25/57 (43%) Frame = +2 Query: 224 AALLREQGGWYQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTK 394 A+LL YQ + + W AV R GGG ++ A GN+ G FA K Sbjct: 297 ASLLESIKTCYQAAGQRWPNFIAVDFYKRSDGGGAPQAVDVANGNLICGCDNFAACK 353 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,469,307 Number of Sequences: 28952 Number of extensions: 327641 Number of successful extensions: 1060 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 977 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1048 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1604469728 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -