BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021133 (652 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value L01616-1|AAA30096.1| 74|Tribolium castaneum zinc finger protei... 23 2.9 DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory pro... 23 2.9 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 23 2.9 EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 22 3.8 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 3.8 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 6.7 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 6.7 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 21 8.8 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 8.8 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 8.8 >L01616-1|AAA30096.1| 74|Tribolium castaneum zinc finger protein protein. Length = 74 Score = 22.6 bits (46), Expect = 2.9 Identities = 6/10 (60%), Positives = 9/10 (90%) Frame = -3 Query: 452 RCKHCRKQFI 423 RC+HC +QF+ Sbjct: 39 RCEHCDRQFV 48 >DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory protein 6 protein. Length = 251 Score = 22.6 bits (46), Expect = 2.9 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +1 Query: 67 STGTFAFLTTK*RKMTNMIPTMWPITLTEP 156 ST T LTTK + PT P+ +T+P Sbjct: 166 STTTRTTLTTKFTTKPSTKPTNKPVVVTKP 195 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 22.6 bits (46), Expect = 2.9 Identities = 6/10 (60%), Positives = 9/10 (90%) Frame = -3 Query: 452 RCKHCRKQFI 423 RC+HC +QF+ Sbjct: 192 RCEHCDRQFV 201 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 22.2 bits (45), Expect = 3.8 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = +1 Query: 511 KILSVLQRKRISLCYEIFRTL 573 KIL V+++ + C E+F L Sbjct: 396 KILKVIRKNLVKKCLELFEEL 416 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.2 bits (45), Expect = 3.8 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -2 Query: 381 PTTTSTSVLDSHTTYPRLG 325 PTTTST+ + T +P G Sbjct: 1065 PTTTSTTTRPTTTNWPTQG 1083 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.4 bits (43), Expect = 6.7 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -1 Query: 526 ELIEFLQRSSSLRFKYNQFFILLTAVVNI 440 ELIE +S F +N F+L+ ++ + Sbjct: 1260 ELIELRNKSVFAFFMFNALFVLVVFLLQL 1288 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.4 bits (43), Expect = 6.7 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -1 Query: 526 ELIEFLQRSSSLRFKYNQFFILLTAVVNI 440 ELIE +S F +N F+L+ ++ + Sbjct: 1260 ELIELRNKSVFAFFMFNALFVLVVFLLQL 1288 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.0 bits (42), Expect = 8.8 Identities = 7/30 (23%), Positives = 16/30 (53%) Frame = -1 Query: 631 LWRQTPQDLTDFTVYVILRTMYEKFHSIMK 542 +W +TP+++ +F V + H I++ Sbjct: 308 MWHETPEEMMEFLKSVFRLDQDQCSHRIVR 337 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.0 bits (42), Expect = 8.8 Identities = 7/30 (23%), Positives = 16/30 (53%) Frame = -1 Query: 631 LWRQTPQDLTDFTVYVILRTMYEKFHSIMK 542 +W +TP+++ +F V + H I++ Sbjct: 541 MWHETPEEMMEFLKSVFRLDQDQCSHRIVR 570 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.0 bits (42), Expect = 8.8 Identities = 7/30 (23%), Positives = 16/30 (53%) Frame = -1 Query: 631 LWRQTPQDLTDFTVYVILRTMYEKFHSIMK 542 +W +TP+++ +F V + H I++ Sbjct: 541 MWHETPEEMMEFLKSVFRLDQDQCSHRIVR 570 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,524 Number of Sequences: 336 Number of extensions: 3596 Number of successful extensions: 11 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16760905 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -