BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021132 (775 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g74060.1 68414.m08578 60S ribosomal protein L6 (RPL6B) simila... 69 3e-12 At1g74050.1 68414.m08576 60S ribosomal protein L6 (RPL6C) simila... 69 3e-12 At1g18540.1 68414.m02313 60S ribosomal protein L6 (RPL6A) simila... 66 2e-11 At2g29210.1 68415.m03550 splicing factor PWI domain-containing p... 30 2.0 At2g27270.1 68415.m03277 expressed protein 29 3.4 At3g46920.1 68416.m05092 protein kinase family protein similar t... 28 6.0 At3g05050.1 68416.m00548 protein kinase family protein contains ... 28 6.0 At3g23890.1 68416.m03002 DNA topoisomerase, ATP-hydrolyzing / DN... 28 7.9 >At1g74060.1 68414.m08578 60S ribosomal protein L6 (RPL6B) similar to 60S ribosomal protein L6 (YL 16 like) GB:CAB57309 from [Cyanophora paradoxa] Length = 233 Score = 69.3 bits (162), Expect = 3e-12 Identities = 37/82 (45%), Positives = 52/82 (63%) Frame = +3 Query: 261 PLKRRKSFYPTQEKIRASSGGRPFSKHVRRIRPNLKIGTVCILLAGRHAGKRVVLVGILP 440 P+++ FYP ++ ++ R +K + +R ++ GTV I+LAGR GKRVV + L Sbjct: 57 PVEKPPKFYPAED-VKKPLPNRRTAKPAK-LRASITPGTVLIILAGRFKGKRVVFLKQLA 114 Query: 441 SGLLLVTGPFAFNSCPLRRIPQ 506 SGLLLVTGPF N PLRR+ Q Sbjct: 115 SGLLLVTGPFKINGVPLRRVNQ 136 Score = 56.8 bits (131), Expect = 1e-08 Identities = 37/93 (39%), Positives = 49/93 (52%) Frame = +2 Query: 482 VPVTPHSSAYVIGTSTRISLGNFKLPKHFNDDYFXXXXXXXXXXXXXXEGDDIFATKKEK 661 VP+ + AYVIGTST++ + L K F+D YF EG+ A K+EK Sbjct: 129 VPLRRVNQAYVIGTSTKVDISGVTLDK-FDDKYFGKVAEKKKKKT---EGEFFEAEKEEK 184 Query: 662 YVPSEQRKTDQKTVDEAVIKAIGARPDKKMLRG 760 + +K DQK VD A+IKAI A P+ K G Sbjct: 185 KEIPQGKKDDQKAVDAALIKAIEAVPELKTYLG 217 >At1g74050.1 68414.m08576 60S ribosomal protein L6 (RPL6C) similar to 60S ribosomal protein L6 (YL 16 like) GB:CAB57309 from [Cyanophora paradoxa] Length = 233 Score = 69.3 bits (162), Expect = 3e-12 Identities = 37/82 (45%), Positives = 52/82 (63%) Frame = +3 Query: 261 PLKRRKSFYPTQEKIRASSGGRPFSKHVRRIRPNLKIGTVCILLAGRHAGKRVVLVGILP 440 P+++ FYP ++ ++ R +K + +R ++ GTV I+LAGR GKRVV + L Sbjct: 57 PVEKPPKFYPAED-VKKPLPNRRTAKPTK-LRASITPGTVLIILAGRFKGKRVVFLKQLA 114 Query: 441 SGLLLVTGPFAFNSCPLRRIPQ 506 SGLLLVTGPF N PLRR+ Q Sbjct: 115 SGLLLVTGPFKINGVPLRRVNQ 136 Score = 56.8 bits (131), Expect = 1e-08 Identities = 37/93 (39%), Positives = 49/93 (52%) Frame = +2 Query: 482 VPVTPHSSAYVIGTSTRISLGNFKLPKHFNDDYFXXXXXXXXXXXXXXEGDDIFATKKEK 661 VP+ + AYVIGTST++ + L K F+D YF EG+ A K+EK Sbjct: 129 VPLRRVNQAYVIGTSTKVDISGVTLDK-FDDKYFGKVAEKKKKKT---EGEFFEAEKEEK 184 Query: 662 YVPSEQRKTDQKTVDEAVIKAIGARPDKKMLRG 760 + +K DQK VD A+IKAI A P+ K G Sbjct: 185 KEIPQVKKDDQKAVDAALIKAIEAVPELKTYLG 217 >At1g18540.1 68414.m02313 60S ribosomal protein L6 (RPL6A) similar to 60S ribosomal protein L6 GI:7208784 from [Cicer arietinum] Length = 233 Score = 66.5 bits (155), Expect = 2e-11 Identities = 36/82 (43%), Positives = 51/82 (62%) Frame = +3 Query: 261 PLKRRKSFYPTQEKIRASSGGRPFSKHVRRIRPNLKIGTVCILLAGRHAGKRVVLVGILP 440 P+++ FYP ++ ++ R K + ++ ++ GTV I+LAGR GKRVV + L Sbjct: 57 PVEKPAKFYPAED-VKKPLVNRRKPKPTK-LKASITPGTVLIILAGRFKGKRVVFLKQLS 114 Query: 441 SGLLLVTGPFAFNSCPLRRIPQ 506 SGLLLVTGPF N PLRR+ Q Sbjct: 115 SGLLLVTGPFKINGVPLRRVNQ 136 Score = 58.8 bits (136), Expect = 4e-09 Identities = 37/93 (39%), Positives = 51/93 (54%) Frame = +2 Query: 482 VPVTPHSSAYVIGTSTRISLGNFKLPKHFNDDYFXXXXXXXXXXXXXXEGDDIFATKKEK 661 VP+ + AYVIGTST+I + K F+D YF EG+ A K+EK Sbjct: 129 VPLRRVNQAYVIGTSTKIDISGVNTEK-FDDKYFGKVAEKKKKKT---EGEFFEAEKEEK 184 Query: 662 YVPSEQRKTDQKTVDEAVIKAIGARPDKKMLRG 760 +++K DQKTVD A+IK+I A P+ K+ G Sbjct: 185 KEIPQEKKEDQKTVDAALIKSIEAVPELKVYLG 217 >At2g29210.1 68415.m03550 splicing factor PWI domain-containing protein contains Pfam profile PF01480: PWI domain Length = 878 Score = 29.9 bits (64), Expect = 2.0 Identities = 12/31 (38%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 261 PLKRRKSFYPTQEKIRASSGGRPFS-KHVRR 350 P++RR+S P +E++ S GGR S H+++ Sbjct: 525 PVRRRRSLTPDEERVSLSQGGRHTSPSHIKQ 555 >At2g27270.1 68415.m03277 expressed protein Length = 231 Score = 29.1 bits (62), Expect = 3.4 Identities = 22/76 (28%), Positives = 38/76 (50%), Gaps = 1/76 (1%) Frame = +3 Query: 288 PTQEKIRASSGGRPFSKHVRRIRPNLKIGTVCILLAGRHAGKRVVLVGILPSGLLLVTGP 467 PT++K A G SKH R + + + C+ GK ++ G+ + +LL+ Sbjct: 21 PTKKKTEAKEEGAAASKHSRVVYSD---KSRCL----SKNGKTIIYFGVPAALILLIICV 73 Query: 468 FAFNSCPLR-RIPQRM 512 FAFN ++ R+P+ M Sbjct: 74 FAFNYIAIQPRVPRFM 89 >At3g46920.1 68416.m05092 protein kinase family protein similar to MAP3K delta-1 protein kinase [Arabidopsis thaliana] GI:2253010; contains Pfam profile: PF00069 Eukaryotic protein kinase domain Length = 1171 Score = 28.3 bits (60), Expect = 6.0 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +2 Query: 422 TCWNSAQRSAFSYWTFCFQFVPVTPHSSAYVI 517 T W S+ S +Y + + VP P SSAYV+ Sbjct: 246 TTWTSSNFSPQTYHSNVSRLVPPDPRSSAYVV 277 >At3g05050.1 68416.m00548 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 593 Score = 28.3 bits (60), Expect = 6.0 Identities = 22/67 (32%), Positives = 34/67 (50%) Frame = +3 Query: 546 TSNCQNTSMMITSRRIRSASNVQSNAKRVMTSLPQKKRNTFHLSSAKPIRRQSTRL*SKP 725 T ++TS ++ + SASN + + + QKK N F ++ AK + + R SKP Sbjct: 40 TETTESTSAVV----VASASNGEE-VRNHEDVVDQKKENGFVVTEAKERKSKGERKRSKP 94 Query: 726 SEPDPTR 746 PDP R Sbjct: 95 --PDPRR 99 >At3g23890.1 68416.m03002 DNA topoisomerase, ATP-hydrolyzing / DNA topoisomerase II / DNA gyrase (TOP2) identical to SP|P30182 DNA topoisomerase II (EC 5.99.1.3) {Arabidopsis thaliana} Length = 1473 Score = 27.9 bits (59), Expect = 7.9 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = +2 Query: 644 ATKKEKYVPSEQRKTDQKTVDEAVIKAIGARPDKKM 751 ATK K P+ RK ++TV + AIG P+KK+ Sbjct: 1354 ATKAAK-PPAAPRKRGKQTVASTEVLAIGVSPEKKV 1388 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,822,160 Number of Sequences: 28952 Number of extensions: 350822 Number of successful extensions: 909 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 881 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 906 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1726528800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -