BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021130 (817 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein... 124 4e-30 AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. 25 3.7 AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. 25 3.7 AY344835-1|AAR05806.1| 334|Anopheles gambiae ICHIT protein. 24 6.4 AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. 24 6.4 CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 23 8.5 >AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein 70 protein. Length = 78 Score = 124 bits (298), Expect = 4e-30 Identities = 58/67 (86%), Positives = 63/67 (94%) Frame = +1 Query: 256 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTFDVS 435 YFNDSQRQATKDAG I+GLNV+RIINEPTAAA+AYGLDK GERNVLIFDLGGGTFDVS Sbjct: 9 YFNDSQRQATKDAGAIAGLNVMRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVS 68 Query: 436 ILTIEDG 456 ILTI++G Sbjct: 69 ILTIDEG 75 >AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 24.6 bits (51), Expect = 3.7 Identities = 8/33 (24%), Positives = 15/33 (45%) Frame = -3 Query: 491 WVSPAVDFTSKIPSSMVRMDTSKVPPPRSKIST 393 W+ P T+ +P++ PPP + +T Sbjct: 221 WIDPTATTTTHVPTTTTTWSDLPPPPPTTTTTT 253 >AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 24.6 bits (51), Expect = 3.7 Identities = 8/33 (24%), Positives = 15/33 (45%) Frame = -3 Query: 491 WVSPAVDFTSKIPSSMVRMDTSKVPPPRSKIST 393 W+ P T+ +P++ PPP + +T Sbjct: 222 WIDPTATTTTHVPTTTTTWSDLPPPPPTTTTTT 254 >AY344835-1|AAR05806.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.8 bits (49), Expect = 6.4 Identities = 8/33 (24%), Positives = 14/33 (42%) Frame = -3 Query: 491 WVSPAVDFTSKIPSSMVRMDTSKVPPPRSKIST 393 W+ P T+ P++ PPP + +T Sbjct: 222 WIDPTATTTTHAPTTTTTWSDQPPPPPTTTTTT 254 >AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.8 bits (49), Expect = 6.4 Identities = 8/33 (24%), Positives = 14/33 (42%) Frame = -3 Query: 491 WVSPAVDFTSKIPSSMVRMDTSKVPPPRSKIST 393 W+ P T+ +P + PPP + +T Sbjct: 222 WIDPTATTTTHVPPTTTTWSDLPPPPPTTTTTT 254 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 23.4 bits (48), Expect = 8.5 Identities = 23/70 (32%), Positives = 35/70 (50%), Gaps = 14/70 (20%) Frame = -3 Query: 488 VSPAVDFTSKIPSSMVRMDTSKVPPP---RSKI---------STFRS-PVPF-LSRP*AI 351 +SP +F++ S++ ++ + PPP RSK T RS PVPF L+ P A Sbjct: 439 ISPPAEFSNGSSKSLLLLNGNGPPPPVPERSKTPNSIYLSQNGTPRSTPVPFALAPPPAA 498 Query: 350 AAAVGSLMIR 321 + A G +R Sbjct: 499 SPAFGDRSVR 508 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 906,309 Number of Sequences: 2352 Number of extensions: 19271 Number of successful extensions: 46 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 42 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 46 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 86487024 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -