BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021126 (877 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_8444| Best HMM Match : BRE (HMM E-Value=6.4) 29 4.9 SB_2342| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 >SB_8444| Best HMM Match : BRE (HMM E-Value=6.4) Length = 502 Score = 29.1 bits (62), Expect = 4.9 Identities = 17/50 (34%), Positives = 27/50 (54%) Frame = -1 Query: 538 IERLNKKGKSNSYANVLAHYKRTIIVVKLNDDQSNKTRMNVKIAGLAGDG 389 ++RL+ +G S + N + Y +IVVK+N SN+ R + AG G Sbjct: 117 LKRLSIEG-SQTLNNAVPQYHNALIVVKINCSTSNQQRKGLIRNNAAGIG 165 >SB_2342| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 430 Score = 28.7 bits (61), Expect = 6.5 Identities = 12/44 (27%), Positives = 22/44 (50%) Frame = -1 Query: 547 VYCIERLNKKGKSNSYANVLAHYKRTIIVVKLNDDQSNKTRMNV 416 V+ ++ L N Y + K +I+VK +D+QS + R + Sbjct: 66 VFTVDALKMMNSGNQYPRLSKPKKGQLILVKSSDEQSKRKRQGI 109 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,445,252 Number of Sequences: 59808 Number of extensions: 489155 Number of successful extensions: 742 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 690 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 742 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2490695009 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -