Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV021126
         (877 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g62230.1 68418.m07814 leucine-rich repeat family protein / pr...    28   9.4  

>At5g62230.1 68418.m07814 leucine-rich repeat family protein /
           protein kinase family protein contains Pfam domains
           PF00560: Leucine Rich Repeat and PF00069: Protein kinase
           domain
          Length = 966

 Score = 27.9 bits (59), Expect = 9.4
 Identities = 14/47 (29%), Positives = 23/47 (48%), Gaps = 2/47 (4%)
 Frame = +3

Query: 711 ADGRNPPWKAISEVSGAF*EVI--VEDWEIVDGRDLCARNGDMSTNI 845
           A   N   KA+  + G+F  ++  + DW+ V   DLC+  G    N+
Sbjct: 23  ASAMNNEGKALMAIKGSFSNLVNMLLDWDDVHNSDLCSWRGVFCDNV 69


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,072,839
Number of Sequences: 28952
Number of extensions: 331147
Number of successful extensions: 584
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 560
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 584
length of database: 12,070,560
effective HSP length: 80
effective length of database: 9,754,400
effective search space used: 2058178400
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)