BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021124 (698 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_01_0493 + 4113869-4116728,4116859-4117370 29 4.7 03_02_0600 - 9748382-9748933,9749805-9749840,9751164-9751218,975... 28 8.2 >05_01_0493 + 4113869-4116728,4116859-4117370 Length = 1123 Score = 28.7 bits (61), Expect = 4.7 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +1 Query: 445 LVLGGAVGGGMTLNKKYAEWKVVFQIWAG 531 L+ GGA+GGG T EW+V I G Sbjct: 860 LLHGGAMGGGATTTAAVVEWEVRLAIAVG 888 >03_02_0600 - 9748382-9748933,9749805-9749840,9751164-9751218, 9751588-9751697,9751955-9752602 Length = 466 Score = 27.9 bits (59), Expect = 8.2 Identities = 13/50 (26%), Positives = 24/50 (48%) Frame = -1 Query: 647 TSFTESWINLQLITDFIFCCNQCSCKSIPLFIVGEQVI*PAHIWKTTFHS 498 T+ + ++L TD + CN S L ++G ++ H+ + FHS Sbjct: 361 TAKEKGMARVELETDSLMLCNALQSNSFNLSVMGGVILEIKHVIASCFHS 410 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,608,553 Number of Sequences: 37544 Number of extensions: 397511 Number of successful extensions: 1040 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1009 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1040 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1792053856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -