BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021124 (698 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC075805-1|AAH75805.1| 960|Homo sapiens optic atrophy 1 (autoso... 44 5e-04 AB011139-1|BAA25493.1| 978|Homo sapiens KIAA0567 protein protein. 44 5e-04 BC039248-1|AAH39248.1| 928|Homo sapiens regulatory factor X dom... 32 2.3 AL355272-1|CAI23444.2| 928|Homo sapiens Regulatory factor X dom... 32 2.3 >BC075805-1|AAH75805.1| 960|Homo sapiens optic atrophy 1 (autosomal dominant) protein. Length = 960 Score = 44.0 bits (99), Expect = 5e-04 Identities = 22/53 (41%), Positives = 31/53 (58%) Frame = +1 Query: 349 LLYKPIDTSHVQKRCYGMLVARAIRGVLKIRYLVLGGAVGGGMTLNKKYAEWK 507 L + PI + +R + AR +LK+RYL+LG AVGGG T K + +WK Sbjct: 73 LKFSPIKYGYQPRRNFWP--ARLATRLLKLRYLILGSAVGGGYTAKKTFDQWK 123 >AB011139-1|BAA25493.1| 978|Homo sapiens KIAA0567 protein protein. Length = 978 Score = 44.0 bits (99), Expect = 5e-04 Identities = 22/53 (41%), Positives = 31/53 (58%) Frame = +1 Query: 349 LLYKPIDTSHVQKRCYGMLVARAIRGVLKIRYLVLGGAVGGGMTLNKKYAEWK 507 L + PI + +R + AR +LK+RYL+LG AVGGG T K + +WK Sbjct: 91 LKFSPIKYGYQPRRNFWP--ARLATRLLKLRYLILGSAVGGGYTAKKTFDQWK 141 >BC039248-1|AAH39248.1| 928|Homo sapiens regulatory factor X domain containing 1 protein. Length = 928 Score = 31.9 bits (69), Expect = 2.3 Identities = 26/77 (33%), Positives = 36/77 (46%), Gaps = 2/77 (2%) Frame = -2 Query: 649 TPASRSRGSICN*SPILSF--AVISVVVNLSHCSLSGSRSFNQPISGRPPSTRHISYSTS 476 +PA SRGS+ N P+ +V V+ SHCS ++ +PI P H YSTS Sbjct: 646 SPAMASRGSVINQGPMAGRPPSVGPVLSAPSHCS-----TYPEPIYPALPQANHDFYSTS 700 Query: 475 CLHQRHHRELSNEFSTL 425 +Q R + S L Sbjct: 701 SNYQTVFRAQPHSTSGL 717 >AL355272-1|CAI23444.2| 928|Homo sapiens Regulatory factor X domain containing 1 protein. Length = 928 Score = 31.9 bits (69), Expect = 2.3 Identities = 26/77 (33%), Positives = 36/77 (46%), Gaps = 2/77 (2%) Frame = -2 Query: 649 TPASRSRGSICN*SPILSF--AVISVVVNLSHCSLSGSRSFNQPISGRPPSTRHISYSTS 476 +PA SRGS+ N P+ +V V+ SHCS ++ +PI P H YSTS Sbjct: 646 SPAMASRGSVINQGPMAGRPPSVGPVLSAPSHCS-----TYPEPIYPTLPQANHDFYSTS 700 Query: 475 CLHQRHHRELSNEFSTL 425 +Q R + S L Sbjct: 701 SNYQTVFRAQPHSTSGL 717 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 103,678,359 Number of Sequences: 237096 Number of extensions: 2268660 Number of successful extensions: 7237 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7085 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7223 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8063224416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -