BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021123 (797 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC040010-1|AAH40010.1| 354|Homo sapiens paraoxonase 2 protein. 31 6.4 AY210982-1|AAO18083.1| 354|Homo sapiens paraoxonase 2 protein. 31 6.4 AC005021-1|AAC62431.1| 354|Homo sapiens unknown protein. 31 6.4 >BC040010-1|AAH40010.1| 354|Homo sapiens paraoxonase 2 protein. Length = 354 Score = 30.7 bits (66), Expect = 6.4 Identities = 23/81 (28%), Positives = 35/81 (43%), Gaps = 2/81 (2%) Frame = +2 Query: 20 LPTKVDISSVEPTDTAIEPVYPGCDYKTVAALMMEPRDPDSLEIRHKGEFSNQFPWVDLP 199 L T VD S++P+ I + GC + +P +P S E+ ++ P V Sbjct: 263 LDTLVDNLSIDPSSGDI---WVGCHPNGQKLFVYDPNNPPSSEVLRIQNILSEKPTVTTV 319 Query: 200 YENGAQTL--SVIAPKHDSKL 256 Y N L S +A +D KL Sbjct: 320 YANNGSVLQGSSVASVYDGKL 340 >AY210982-1|AAO18083.1| 354|Homo sapiens paraoxonase 2 protein. Length = 354 Score = 30.7 bits (66), Expect = 6.4 Identities = 23/81 (28%), Positives = 35/81 (43%), Gaps = 2/81 (2%) Frame = +2 Query: 20 LPTKVDISSVEPTDTAIEPVYPGCDYKTVAALMMEPRDPDSLEIRHKGEFSNQFPWVDLP 199 L T VD S++P+ I + GC + +P +P S E+ ++ P V Sbjct: 263 LDTLVDNLSIDPSSGDI---WVGCHPNGQKLFVYDPNNPPSSEVLRIQNILSEKPTVTTV 319 Query: 200 YENGAQTL--SVIAPKHDSKL 256 Y N L S +A +D KL Sbjct: 320 YANNGSVLQGSSVASVYDGKL 340 >AC005021-1|AAC62431.1| 354|Homo sapiens unknown protein. Length = 354 Score = 30.7 bits (66), Expect = 6.4 Identities = 23/81 (28%), Positives = 35/81 (43%), Gaps = 2/81 (2%) Frame = +2 Query: 20 LPTKVDISSVEPTDTAIEPVYPGCDYKTVAALMMEPRDPDSLEIRHKGEFSNQFPWVDLP 199 L T VD S++P+ I + GC + +P +P S E+ ++ P V Sbjct: 263 LDTLVDNLSIDPSSGDI---WVGCHPNGQKLFVYDPNNPPSSEVLRIQNILSEKPTVTTV 319 Query: 200 YENGAQTL--SVIAPKHDSKL 256 Y N L S +A +D KL Sbjct: 320 YANNGSVLQGSSVASVYDGKL 340 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 131,854,647 Number of Sequences: 237096 Number of extensions: 3213259 Number of successful extensions: 7652 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7107 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7652 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9813323168 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -