BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021122 (721 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g02870.1 68418.m00230 60S ribosomal protein L4/L1 (RPL4D) 60S... 109 2e-24 At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) str... 109 2e-24 At5g07520.1 68418.m00861 glycine-rich protein (GRP18) Oleosin; g... 31 0.58 At1g57750.1 68414.m06552 cytochrome P450, putative similar to cy... 30 1.3 At4g26590.1 68417.m03833 oligopeptide transporter OPT family pro... 29 2.3 At5g55100.2 68418.m06869 SWAP (Suppressor-of-White-APricot)/surp... 29 3.1 At5g55100.1 68418.m06868 SWAP (Suppressor-of-White-APricot)/surp... 29 3.1 At4g39480.1 68417.m05585 cytochrome P450 family protein contains... 28 5.4 At5g17650.1 68418.m02069 glycine/proline-rich protein glycine/pr... 28 7.2 At3g12430.1 68416.m01548 expressed protein ; expression supporte... 28 7.2 At1g80480.1 68414.m09427 PRLI-interacting factor L, putative sim... 27 9.5 At1g11790.1 68414.m01353 prephenate dehydratase family protein s... 27 9.5 >At5g02870.1 68418.m00230 60S ribosomal protein L4/L1 (RPL4D) 60S roibosomal protein L4, Arabidopsis thaliana, EMBL:CAA79104 Length = 407 Score = 109 bits (262), Expect = 2e-24 Identities = 46/51 (90%), Positives = 48/51 (94%) Frame = +1 Query: 256 TSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRRWH 408 TSAESWGTGRAV+RIPRV GGGTHR+GQ AFGNMCRGGRMFAPTK WRRWH Sbjct: 68 TSAESWGTGRAVSRIPRVPGGGTHRAGQAAFGNMCRGGRMFAPTKIWRRWH 118 Score = 67.7 bits (158), Expect = 7e-12 Identities = 34/63 (53%), Positives = 41/63 (65%), Gaps = 2/63 (3%) Frame = +2 Query: 74 SVARPLVSVYSEKSE--TVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSKEA 247 + ARPLV+V + T Q LP V AP+RPD+VN VH +S NSRQPY VSK+A Sbjct: 5 AAARPLVTVQGLDGDMSTDQSTTVTLPDVMTAPVRPDIVNFVHAQISNNSRQPYAVSKKA 64 Query: 248 GHQ 256 GHQ Sbjct: 65 GHQ 67 Score = 50.4 bits (115), Expect = 1e-06 Identities = 27/88 (30%), Positives = 41/88 (46%) Frame = +3 Query: 450 SVAATGVPALVQARGHIIEKFPSFPWL*PTKSKIINKTKQAVIFLRRLKAWSDILKVYKS 629 ++AAT VPALV ARGH IE P P + ++ + KT A+ L+++ A+ D K S Sbjct: 133 AIAATAVPALVMARGHKIENVPEMPLVVSDSAEAVEKTSAAIKVLKQIGAYDDAEKAKNS 192 Query: 630 QXXXXXXXXXXXXXXXXXXXPLIIFNKD 713 PL++F + Sbjct: 193 IGIRPGKGKMRNRRYISRKGPLVVFGTE 220 >At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) strong similarity to 60S ribosomal protein L1 GB:P49691 Length = 406 Score = 109 bits (262), Expect = 2e-24 Identities = 46/51 (90%), Positives = 48/51 (94%) Frame = +1 Query: 256 TSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRRWH 408 TSAESWGTGRAV+RIPRV GGGTHR+GQ AFGNMCRGGRMFAPTK WRRWH Sbjct: 67 TSAESWGTGRAVSRIPRVPGGGTHRAGQAAFGNMCRGGRMFAPTKIWRRWH 117 Score = 69.7 bits (163), Expect = 2e-12 Identities = 34/66 (51%), Positives = 45/66 (68%), Gaps = 2/66 (3%) Frame = +2 Query: 65 MSLSVARPLVSVYSEKSE--TVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVS 238 M+ + ARPLV++ + + T Q + LP V AP+RPD+VN VH +S NSRQPY VS Sbjct: 1 MAAAAARPLVTIQTLDGDMSTDQSSTVVLPDVMTAPVRPDIVNFVHAQISNNSRQPYAVS 60 Query: 239 KEAGHQ 256 K+AGHQ Sbjct: 61 KKAGHQ 66 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/60 (40%), Positives = 35/60 (58%) Frame = +3 Query: 450 SVAATGVPALVQARGHIIEKFPSFPWL*PTKSKIINKTKQAVIFLRRLKAWSDILKVYKS 629 ++AAT VPALV ARGH IE P P + ++ + KT A+ L+++ A+ D K S Sbjct: 132 AIAATAVPALVMARGHKIENVPEMPLVVSDSAEAVEKTSAAIKVLKQIGAYDDAEKAKNS 191 >At5g07520.1 68418.m00861 glycine-rich protein (GRP18) Oleosin; glycine-rich protein 18 (GRP18) PMID:11431566; Length = 228 Score = 31.5 bits (68), Expect = 0.58 Identities = 20/64 (31%), Positives = 29/64 (45%), Gaps = 3/64 (4%) Frame = +1 Query: 214 LEAALLREQGGWSPTSAESWGTGRAVARIPRVRGGGTHRSGQ---GAFGNMCRGGRMFAP 384 + AL+R + G PT AE + + + ++P G G G+ G FGN GG F Sbjct: 76 MAVALIRRRMGAKPT-AEGTSSAQPLLKLPVYGGYGGFWGGKKFSGTFGNKPGGGNPFGD 134 Query: 385 TKPW 396 W Sbjct: 135 ISKW 138 >At1g57750.1 68414.m06552 cytochrome P450, putative similar to cytochrome P450 GI:4688670 from [Catharanthus roseus] Length = 497 Score = 30.3 bits (65), Expect = 1.3 Identities = 21/70 (30%), Positives = 35/70 (50%) Frame = +2 Query: 89 LVSVYSEKSETVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSKEAGHQPVLN 268 LV +++ SE+++ PLPF K+P +PD++ H + NS+ C+ + V Sbjct: 351 LVYLHAALSESMR-LYPPLPFNHKSPAKPDVLPSGH-KVDANSKIVICIYALGRMRSVWG 408 Query: 269 HGVLDVLSPE 298 LD PE Sbjct: 409 EDALD-FKPE 417 >At4g26590.1 68417.m03833 oligopeptide transporter OPT family protein similar to SP|P40900 Sexual differentiation process protein isp4 {Schizosaccharomyces pombe}; contains Pfam profile PF03169: OPT oligopeptide transporter protein Length = 753 Score = 29.5 bits (63), Expect = 2.3 Identities = 15/48 (31%), Positives = 23/48 (47%) Frame = -1 Query: 577 MTACLVLLIILDFVGYNQGKLGNFSIMCPLA*TSAGTPVAATLPPRPL 434 M +C+VL + +F GY L S++ + G +A TLP L Sbjct: 61 MVSCVVLAFVNNFFGYRSNPLTVSSVVAQIITLPLGKLMATTLPTTKL 108 >At5g55100.2 68418.m06869 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein contains Pfam domain PF01805: Surp module Length = 844 Score = 29.1 bits (62), Expect = 3.1 Identities = 12/41 (29%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -1 Query: 379 RTYVHHDTCYRRHPDRTY-EYHHHGHAEFGRQHVQYPMIQH 260 R++ H + +H D + E+HHH H R+H ++H Sbjct: 735 RSHHHRSRKHEKHRDSSDDEHHHHRHRSSRRKHEDSSDVEH 775 >At5g55100.1 68418.m06868 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein contains Pfam domain PF01805: Surp module Length = 843 Score = 29.1 bits (62), Expect = 3.1 Identities = 12/41 (29%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -1 Query: 379 RTYVHHDTCYRRHPDRTY-EYHHHGHAEFGRQHVQYPMIQH 260 R++ H + +H D + E+HHH H R+H ++H Sbjct: 735 RSHHHRSRKHEKHRDSSDDEHHHHRHRSSRRKHEDSSDVEH 775 >At4g39480.1 68417.m05585 cytochrome P450 family protein contains Pfam profile: PF00067 cytochrome P450 Length = 989 Score = 28.3 bits (60), Expect = 5.4 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +2 Query: 140 PLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCV 235 P+PF K+P +PD++ H + NSR +C+ Sbjct: 384 PVPFNHKSPAKPDVLPSGH-KVKANSRILFCL 414 Score = 27.5 bits (58), Expect = 9.5 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = +2 Query: 140 PLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCV 235 P+PF K+P +PD++ H + NS+ +C+ Sbjct: 857 PVPFQHKSPTKPDVLPSGH-KVDANSKILFCL 887 >At5g17650.1 68418.m02069 glycine/proline-rich protein glycine/proline-rich protein GPRP - Arabidopsis thaliana, EMBL:X84315 Length = 173 Score = 27.9 bits (59), Expect = 7.2 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = -1 Query: 367 HHDTCYRRHPDRTYEYHHHGHAEF 296 HH Y H Y Y +HGH +F Sbjct: 122 HHHGHYGHHHGHGYGYGYHGHGKF 145 >At3g12430.1 68416.m01548 expressed protein ; expression supported by MPSS Length = 238 Score = 27.9 bits (59), Expect = 7.2 Identities = 12/40 (30%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Frame = -3 Query: 143 GAWLHPAPSHSSLNTPTLKVGLPID--SFRYFSEAIPLKY 30 G W+H SH+ ++ L VG+ + Y+S + P++Y Sbjct: 38 GQWIHDVLSHNRFSSHPLVVGVGVQWTPSSYYSASSPVRY 77 >At1g80480.1 68414.m09427 PRLI-interacting factor L, putative similar to PRLI-interacting factor L [Arabidopsis thaliana] GI:11139268; contains Pfam profile PF02492: Cobalamin synthesis protein/P47K Length = 444 Score = 27.5 bits (58), Expect = 9.5 Identities = 9/28 (32%), Positives = 13/28 (46%) Frame = -1 Query: 367 HHDTCYRRHPDRTYEYHHHGHAEFGRQH 284 HHD + H D +++ HH H H Sbjct: 311 HHDHDHDHHHDHNHDHDHHHHDGHDHHH 338 >At1g11790.1 68414.m01353 prephenate dehydratase family protein similar to gi|2392772 and is a member of the PF|00800 Prephenate dehydratase family. ESTs gb|T21562 and gb|T21062 come from this gene Length = 392 Score = 27.5 bits (58), Expect = 9.5 Identities = 15/46 (32%), Positives = 23/46 (50%) Frame = -3 Query: 623 VHLKDIRPCLEAPQEDDSLFGLVDNLGLCRLQPREAREFFNNVSSS 486 V +DI+ L PQ D ++NLG+ R+ ++ VSSS Sbjct: 196 VKKEDIKCVLSHPQALDQCVNSLNNLGIQRISAKDTATAAQTVSSS 241 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,461,619 Number of Sequences: 28952 Number of extensions: 301008 Number of successful extensions: 949 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 868 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 937 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1565336320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -