BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021119X (561 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_03_0605 - 16141361-16141398,16141585-16141885,16143980-16144492 31 0.83 10_01_0152 - 1754113-1754286,1754396-1754551,1755273-1756194,175... 28 4.4 06_01_0869 - 6616667-6616945,6618006-6619241 28 4.4 06_03_0528 + 21782567-21782651,21783355-21783563,21784095-217842... 28 5.9 07_03_1567 - 27772815-27773302,27773471-27773561,27773641-277739... 27 7.7 >05_03_0605 - 16141361-16141398,16141585-16141885,16143980-16144492 Length = 283 Score = 30.7 bits (66), Expect = 0.83 Identities = 25/79 (31%), Positives = 40/79 (50%), Gaps = 3/79 (3%) Frame = +3 Query: 225 YQDAYGFRMRCDLVSKEWLLAKLRSDERDTVLIDCRGSNE--YSVSHIRSAVNFSIPTIM 398 +QDA+ R+RC +V LA D R L RG++ ++V HI V + P Sbjct: 4 FQDAHFVRLRCSVVRCSKYLA-AEDDGRGVCLSGQRGAHNTVWAVEHITGDVPGAAPGPY 62 Query: 399 LR-RIAAGKIELSSTVQCK 452 +R R A G+ +++ +Q K Sbjct: 63 VRLRGAYGRYLVATDLQAK 81 >10_01_0152 - 1754113-1754286,1754396-1754551,1755273-1756194, 1756364-1756414,1757540-1757946,1758918-1759067, 1759178-1759333,1760175-1761041 Length = 960 Score = 28.3 bits (60), Expect = 4.4 Identities = 14/60 (23%), Positives = 28/60 (46%) Frame = -1 Query: 384 WKSSQRNGCAIQNTRLSPDNLSIRCLFRLNVTSQGAILSTPGRIAF*IHRHLDSTLFSSV 205 W+S + CA+ + +S L + + +S +STP + R +DS +F+ + Sbjct: 190 WESLFLDECAVNDVEISSQTLKVLTIKNTLFSSDKTTISTPSVTYLKLWRPVDSCVFNDM 249 >06_01_0869 - 6616667-6616945,6618006-6619241 Length = 504 Score = 28.3 bits (60), Expect = 4.4 Identities = 15/58 (25%), Positives = 25/58 (43%), Gaps = 1/58 (1%) Frame = +2 Query: 374 ELFHPNNNA*ADSC-WED*VVINSAVQRVEGDDKPLSNPWYIRVVRDGPPRDPDSVHG 544 ELFH D W+ V+ + + G+ KPL W++ + P P+ + G Sbjct: 404 ELFHQYMEMNEDGVLWDPTSVLPAGLMTFYGNTKPLDKSWHVMGLGYNPSISPEVIAG 461 >06_03_0528 + 21782567-21782651,21783355-21783563,21784095-21784232, 21784520-21784734,21784813-21784967,21785010-21785071, 21785832-21785834 Length = 288 Score = 27.9 bits (59), Expect = 5.9 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = -3 Query: 340 FEPRQSINTVSLSSERNFARSH 275 F +++N + LSSERN++R H Sbjct: 27 FTGLKAVNKIGLSSERNYSRGH 48 >07_03_1567 - 27772815-27773302,27773471-27773561,27773641-27773988, 27774929-27775110,27775191-27775368,27775453-27775605, 27775993-27776232,27776369-27776449,27776485-27776730, 27777151-27777240,27777536-27777778,27778365-27778529, 27779017-27779080,27779162-27779286,27779383-27779476, 27779647-27779714,27779798-27779989,27780618-27780752, 27780847-27780934,27781014-27781107,27781484-27781547, 27781657-27781708,27781911-27782014,27782099-27782158, 27782687-27782770,27782892-27783125,27783442-27783864, 27784675-27784736,27784867-27785521 Length = 1700 Score = 27.5 bits (58), Expect = 7.7 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +1 Query: 145 SRLHVGIDATGYSKW*KVRVNRRKQCTIKM 234 +RL VGI GY W K+R++ + T K+ Sbjct: 1335 ARLMVGIHWYGYGNWEKIRLDPKLSLTAKI 1364 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,765,398 Number of Sequences: 37544 Number of extensions: 293105 Number of successful extensions: 752 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 737 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 752 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1281410928 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -