BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021118 (724 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.) 154 8e-38 SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.) 152 2e-37 SB_56| Best HMM Match : Actin (HMM E-Value=0) 152 2e-37 SB_56628| Best HMM Match : Actin (HMM E-Value=0) 152 2e-37 SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.) 151 7e-37 SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.) 150 1e-36 SB_13344| Best HMM Match : Actin (HMM E-Value=1.5e-07) 136 1e-32 SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 6e-19 SB_54| Best HMM Match : Actin (HMM E-Value=0) 85 7e-17 SB_26136| Best HMM Match : Actin (HMM E-Value=7.2e-10) 52 6e-07 SB_27656| Best HMM Match : Actin (HMM E-Value=4.79999e-40) 38 0.006 SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07) 38 0.008 SB_22343| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.058 SB_49385| Best HMM Match : Actin (HMM E-Value=0.00022) 34 0.10 SB_30721| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_9926| Best HMM Match : DPPIV_N (HMM E-Value=0) 32 0.54 SB_1624| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_42882| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 30 2.2 SB_59350| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_22949| Best HMM Match : rve (HMM E-Value=1.2e-19) 29 5.0 >SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 154 bits (373), Expect = 8e-38 Identities = 69/72 (95%), Positives = 71/72 (98%) Frame = -1 Query: 724 KSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANT 545 KSYELPDGQVITIGNERFRCPEA+FQPSFLGME+ GIHETTYNSIMKCDVDIRKDLYANT Sbjct: 201 KSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANT 260 Query: 544 VLSGGTTMYPGI 509 VLSGGTTMYPGI Sbjct: 261 VLSGGTTMYPGI 272 Score = 133 bits (322), Expect = 1e-31 Identities = 62/69 (89%), Positives = 64/69 (92%) Frame = -3 Query: 518 PWNPDRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSIXASLSTFQQMWISKQEYDESG 339 P DRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSI ASLSTFQQMWISKQEYDESG Sbjct: 270 PGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESG 329 Query: 338 PSIVHRKCF 312 P+IVHRKCF Sbjct: 330 PAIVHRKCF 338 >SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 152 bits (369), Expect = 2e-37 Identities = 68/72 (94%), Positives = 71/72 (98%) Frame = -1 Query: 724 KSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANT 545 KSYELPDGQVITIGNERFRCPEA+FQPSFLGME+ GIHETTYNSIMKCDVDIRKDLYANT Sbjct: 239 KSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANT 298 Query: 544 VLSGGTTMYPGI 509 VLSGG+TMYPGI Sbjct: 299 VLSGGSTMYPGI 310 Score = 135 bits (326), Expect = 4e-32 Identities = 63/69 (91%), Positives = 64/69 (92%) Frame = -3 Query: 518 PWNPDRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSIXASLSTFQQMWISKQEYDESG 339 P DRMQKEIT+LAP TMKIKIIAPPERKYSVWIGGSI ASLSTFQQMWISKQEYDESG Sbjct: 308 PGIADRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESG 367 Query: 338 PSIVHRKCF 312 PSIVHRKCF Sbjct: 368 PSIVHRKCF 376 >SB_56| Best HMM Match : Actin (HMM E-Value=0) Length = 375 Score = 152 bits (369), Expect = 2e-37 Identities = 68/72 (94%), Positives = 71/72 (98%) Frame = -1 Query: 724 KSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANT 545 KSYELPDGQVITIGNERFRCPEA+FQPSFLGME+ GIHETTYNSIMKCDVDIRKDLYANT Sbjct: 238 KSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANT 297 Query: 544 VLSGGTTMYPGI 509 VLSGG+TMYPGI Sbjct: 298 VLSGGSTMYPGI 309 Score = 135 bits (326), Expect = 4e-32 Identities = 63/69 (91%), Positives = 64/69 (92%) Frame = -3 Query: 518 PWNPDRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSIXASLSTFQQMWISKQEYDESG 339 P DRMQKEIT+LAP TMKIKIIAPPERKYSVWIGGSI ASLSTFQQMWISKQEYDESG Sbjct: 307 PGIADRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESG 366 Query: 338 PSIVHRKCF 312 PSIVHRKCF Sbjct: 367 PSIVHRKCF 375 >SB_56628| Best HMM Match : Actin (HMM E-Value=0) Length = 376 Score = 152 bits (369), Expect = 2e-37 Identities = 68/72 (94%), Positives = 71/72 (98%) Frame = -1 Query: 724 KSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANT 545 KSYELPDGQVITIGNERFRCPEA+FQPSFLGME+ GIHETTYNSIMKCDVDIRKDLYANT Sbjct: 239 KSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANT 298 Query: 544 VLSGGTTMYPGI 509 VLSGG+TMYPGI Sbjct: 299 VLSGGSTMYPGI 310 Score = 134 bits (325), Expect = 5e-32 Identities = 63/69 (91%), Positives = 64/69 (92%) Frame = -3 Query: 518 PWNPDRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSIXASLSTFQQMWISKQEYDESG 339 P DRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSI ASLSTFQQMWISKQEYDESG Sbjct: 308 PGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESG 367 Query: 338 PSIVHRKCF 312 PSIVHRKCF Sbjct: 368 PSIVHRKCF 376 >SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 151 bits (365), Expect = 7e-37 Identities = 67/72 (93%), Positives = 71/72 (98%) Frame = -1 Query: 724 KSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANT 545 KSYELPDGQVITIGNERFRCPEA+FQPSFLGME+ GIHETTYNSIMKCDVDIRKDLYANT Sbjct: 238 KSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANT 297 Query: 544 VLSGGTTMYPGI 509 VLSGG+TM+PGI Sbjct: 298 VLSGGSTMFPGI 309 Score = 134 bits (325), Expect = 5e-32 Identities = 63/69 (91%), Positives = 64/69 (92%) Frame = -3 Query: 518 PWNPDRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSIXASLSTFQQMWISKQEYDESG 339 P DRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSI ASLSTFQQMWISKQEYDESG Sbjct: 307 PGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESG 366 Query: 338 PSIVHRKCF 312 PSIVHRKCF Sbjct: 367 PSIVHRKCF 375 >SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 349 Score = 150 bits (364), Expect = 1e-36 Identities = 67/72 (93%), Positives = 70/72 (97%) Frame = -1 Query: 724 KSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANT 545 KSYELPDGQVITIGNERFRCPEAL QPSFLGME+ GIHETTYNSIMKCDVDIRKDLYANT Sbjct: 212 KSYELPDGQVITIGNERFRCPEALLQPSFLGMESSGIHETTYNSIMKCDVDIRKDLYANT 271 Query: 544 VLSGGTTMYPGI 509 V+SGGTTMYPG+ Sbjct: 272 VMSGGTTMYPGL 283 Score = 135 bits (327), Expect = 3e-32 Identities = 63/69 (91%), Positives = 65/69 (94%) Frame = -3 Query: 518 PWNPDRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSIXASLSTFQQMWISKQEYDESG 339 P DRMQKEI+ALAPSTMKIKIIAPPERKYSVWIGGSI ASLSTFQQMWISKQEYDESG Sbjct: 281 PGLADRMQKEISALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESG 340 Query: 338 PSIVHRKCF 312 P+IVHRKCF Sbjct: 341 PAIVHRKCF 349 >SB_13344| Best HMM Match : Actin (HMM E-Value=1.5e-07) Length = 149 Score = 136 bits (330), Expect = 1e-32 Identities = 60/72 (83%), Positives = 67/72 (93%) Frame = -1 Query: 724 KSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANT 545 K+YELPDGQVI+IGNERFRCPEA+FQP+FLGMEA GIHE YN IMKCDVDIRKDLY+N Sbjct: 12 KTYELPDGQVISIGNERFRCPEAMFQPAFLGMEAPGIHEAIYNCIMKCDVDIRKDLYSNC 71 Query: 544 VLSGGTTMYPGI 509 VLSGG+TM+PGI Sbjct: 72 VLSGGSTMFPGI 83 Score = 117 bits (282), Expect = 8e-27 Identities = 53/69 (76%), Positives = 59/69 (85%) Frame = -3 Query: 518 PWNPDRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSIXASLSTFQQMWISKQEYDESG 339 P DRMQKEI LA ++MK+K+IAPPERKYSVWIGGSI ASLSTFQQMWI+K+EY E G Sbjct: 81 PGIADRMQKEIAMLANASMKVKVIAPPERKYSVWIGGSILASLSTFQQMWIAKEEYHEYG 140 Query: 338 PSIVHRKCF 312 P IVHRKCF Sbjct: 141 PPIVHRKCF 149 >SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 411 Score = 91.5 bits (217), Expect = 6e-19 Identities = 37/79 (46%), Positives = 54/79 (68%) Frame = -1 Query: 724 KSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANT 545 + Y LPDG+V+ + ERF PEALFQP + +E G+ E +N+I D+D R + Y + Sbjct: 242 EQYTLPDGRVVKLSGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKHI 301 Query: 544 VLSGGTTMYPGIPTVCKRK 488 VLSGG+TMYPG+P+ +R+ Sbjct: 302 VLSGGSTMYPGLPSRLERE 320 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/42 (38%), Positives = 28/42 (66%), Gaps = 1/42 (2%) Frame = -3 Query: 461 KIKIIAPPERKYSVWIGGSIXAS-LSTFQQMWISKQEYDESG 339 KI+I PP RK+ V++GG++ A + W++++EY+E G Sbjct: 358 KIRIEDPPRRKHMVFMGGAVLADIMKDKDSFWMTRKEYEEKG 399 >SB_54| Best HMM Match : Actin (HMM E-Value=0) Length = 2486 Score = 84.6 bits (200), Expect = 7e-17 Identities = 38/62 (61%), Positives = 46/62 (74%) Frame = -1 Query: 718 YELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVL 539 Y LPDGQ I IG+ERFR E LFQPS LG + GIHE+ + SI KCD+D+R +L+ N VL Sbjct: 2285 YMLPDGQSIRIGSERFRAAEPLFQPSLLGRDIDGIHESIFKSIKKCDIDLRAELFHNIVL 2344 Query: 538 SG 533 SG Sbjct: 2345 SG 2346 >SB_26136| Best HMM Match : Actin (HMM E-Value=7.2e-10) Length = 543 Score = 51.6 bits (118), Expect = 6e-07 Identities = 24/60 (40%), Positives = 33/60 (55%), Gaps = 1/60 (1%) Frame = -1 Query: 694 ITIGNERFRCPEALFQPSFLGME-ACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMY 518 + + ERF PE F P F + + E N I C +D+R+ LY N VLSGG+TM+ Sbjct: 196 VDVAYERFLGPEIFFHPEFSNPDFTTPLSEVVDNVIQNCPIDVRRPLYKNIVLSGGSTMF 255 Score = 47.2 bits (107), Expect = 1e-05 Identities = 22/60 (36%), Positives = 35/60 (58%) Frame = -3 Query: 479 LAPSTMKIKIIAPPERKYSVWIGGSIXASLSTFQQMWISKQEYDESGPSIVHRKCF*THR 300 + P ++ ++I+ ++Y+VW GGS+ AS F + +K +YDE GPSI F HR Sbjct: 285 IKPKPIETQVISHHMQRYAVWFGGSMLASTPEFYSVCHTKADYDEHGPSICRHNPF-LHR 343 >SB_27656| Best HMM Match : Actin (HMM E-Value=4.79999e-40) Length = 367 Score = 38.3 bits (85), Expect = 0.006 Identities = 15/28 (53%), Positives = 23/28 (82%) Frame = -1 Query: 595 SIMKCDVDIRKDLYANTVLSGGTTMYPG 512 +I K D+D+R+ LY+N VLSGG+T++ G Sbjct: 264 AIQKSDLDLRRVLYSNIVLSGGSTLFKG 291 >SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07) Length = 240 Score = 37.9 bits (84), Expect = 0.008 Identities = 16/42 (38%), Positives = 30/42 (71%), Gaps = 3/42 (7%) Frame = -3 Query: 506 DRMQKEITALAPSTMKIKIIA---PPERKYSVWIGGSIXASL 390 +R+ +E+ + P +M++K+I+ E++++ WIGGSI ASL Sbjct: 189 ERLNRELVSKTPPSMRLKLISNNSSVEKRFNPWIGGSILASL 230 Score = 33.1 bits (72), Expect = 0.23 Identities = 13/41 (31%), Positives = 23/41 (56%) Frame = -1 Query: 634 GMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPG 512 G A G+ + S+ D+DIR L+ + +++GG T+ G Sbjct: 146 GSTAMGVTQVVTTSVGMTDIDIRAGLFNSVIVTGGNTLLQG 186 >SB_22343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 35.1 bits (77), Expect = 0.058 Identities = 15/29 (51%), Positives = 19/29 (65%) Frame = -1 Query: 598 NSIMKCDVDIRKDLYANTVLSGGTTMYPG 512 +S++ C +D RK L N VL GGT M PG Sbjct: 64 DSLLLCPIDTRKTLAENIVLIGGTAMTPG 92 >SB_49385| Best HMM Match : Actin (HMM E-Value=0.00022) Length = 921 Score = 34.3 bits (75), Expect = 0.10 Identities = 16/30 (53%), Positives = 19/30 (63%) Frame = -1 Query: 724 KSYELPDGQVITIGNERFRCPEALFQPSFL 635 K Y LPDGQ+I+IG E E LF+P L Sbjct: 869 KFYTLPDGQMISIGYECISSMEPLFRPDLL 898 >SB_30721| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 40 Score = 31.9 bits (69), Expect = 0.54 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = -1 Query: 664 PEALFQPSFLGMEACGIHET 605 PE +FQPS LG+E GI ET Sbjct: 3 PEIIFQPSMLGLEQAGITET 22 >SB_9926| Best HMM Match : DPPIV_N (HMM E-Value=0) Length = 1066 Score = 31.9 bits (69), Expect = 0.54 Identities = 15/50 (30%), Positives = 28/50 (56%), Gaps = 2/50 (4%) Frame = -1 Query: 385 PSNRCGSRNRSTTSLAPPLYTGSASK--RTARRCLQQPAAGCSIQAVISV 242 P N+ G++ R +L P++TGS + RT + P+A C ++++V Sbjct: 879 PGNQAGNKTRPLRALRSPIHTGSTLEVDRTRQGTRPDPSARCDPLSILAV 928 >SB_1624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 427 Score = 31.9 bits (69), Expect = 0.54 Identities = 14/28 (50%), Positives = 20/28 (71%) Frame = +1 Query: 175 RPALRPAVTITLITIISYVQLN*RRLQP 258 RP + PA T TLIT+I YV+++ L+P Sbjct: 125 RPLMTPAKTGTLITVIDYVEIDKTLLEP 152 >SB_42882| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 1973 Score = 29.9 bits (64), Expect = 2.2 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = +1 Query: 403 IDPPIHTEYFLSGGAMILIFIVDGARAVISFCIRSGF 513 +DPP+ +Y L+GG ++ + FCI GF Sbjct: 758 LDPPLENKYNLNGGQQVIQSTLQIQSLFFPFCIFQGF 794 >SB_59350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 987 Score = 29.1 bits (62), Expect = 3.8 Identities = 15/63 (23%), Positives = 27/63 (42%), Gaps = 6/63 (9%) Frame = +1 Query: 394 EAXIDPPIHTEYFLSGGAMILIFIVDGARAVISF------CIRSGFQGTWWYHRTIRCWR 555 E +D P+H YF + ++L I + ++ +F I W+H+ CW Sbjct: 645 EKELDLPVHNTYFWTDSTIVLQSIENKSKRFKTFFANRLSTIHDISSPDQWFHKQEECWP 704 Query: 556 TSP 564 + P Sbjct: 705 SQP 707 >SB_22949| Best HMM Match : rve (HMM E-Value=1.2e-19) Length = 158 Score = 28.7 bits (61), Expect = 5.0 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -2 Query: 696 SSLSETKDSVAQRLSSNPRSWVWK 625 S+ SETK SV +R + + W+W+ Sbjct: 96 STKSETKASVVERFNRTSKEWMWR 119 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,688,247 Number of Sequences: 59808 Number of extensions: 485285 Number of successful extensions: 1317 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 1224 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1314 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1925890720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -