BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021115 (738 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_O97278 Cluster: Transporter, putative; n=2; Plasmodium|... 33 9.7 >UniRef50_O97278 Cluster: Transporter, putative; n=2; Plasmodium|Rep: Transporter, putative - Plasmodium falciparum (isolate 3D7) Length = 3133 Score = 32.7 bits (71), Expect = 9.7 Identities = 15/47 (31%), Positives = 27/47 (57%), Gaps = 1/47 (2%) Frame = +2 Query: 437 CFYLNIICFNVNGLCEISVDRF-CILSFSLKIKFSRIWIFIYLMILF 574 C ++ ICF++N +I+++ F C L + K + W+ Y +ILF Sbjct: 587 CLFIVNICFDINKERKINIENFLCCLKIN-KYYYYYSWLLFYFIILF 632 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 615,057,952 Number of Sequences: 1657284 Number of extensions: 10294859 Number of successful extensions: 19643 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 19163 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19642 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 60088620670 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -