BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021114 (695 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbona... 27 0.75 AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylch... 25 1.7 AY748841-1|AAV28189.1| 158|Anopheles gambiae cytochrome P450 pr... 25 2.3 AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 24 4.0 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 24 4.0 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 24 4.0 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 24 4.0 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 24 4.0 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 24 4.0 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 24 4.0 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 24 4.0 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 24 4.0 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 24 4.0 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 24 4.0 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 24 4.0 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 23 7.0 AJ439060-4|CAD27755.1| 151|Anopheles gambiae putative sRNP prot... 23 9.2 AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 23 9.2 >AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbonate anion exchanger protein. Length = 1102 Score = 26.6 bits (56), Expect = 0.75 Identities = 16/43 (37%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = +1 Query: 139 GHAPRAREVLAHRPGGQRA---RRRHLLRQPTDQNGKRGDQQS 258 GH V H PG R RRRH Q + +NG +G S Sbjct: 30 GHRAHTVFVGVHIPGSSRRHSQRRRHKHHQASRENGDKGSTGS 72 >AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 3 protein. Length = 710 Score = 25.4 bits (53), Expect = 1.7 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 378 HLHDRHDLAGHGLLRAQPQHAPIRRQGEGARHH 476 HL D + L P H R G G RHH Sbjct: 402 HLLDSSESLNTCRLHGSPTHLHNHRSGGGGRHH 434 >AY748841-1|AAV28189.1| 158|Anopheles gambiae cytochrome P450 protein. Length = 158 Score = 25.0 bits (52), Expect = 2.3 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = +3 Query: 291 GHEGQQPPALPRVQAHAGPARQLHRGQVSHLHDRHDL 401 G+ Q P R+QA A + H QV L DR ++ Sbjct: 46 GYIVQHPEVQQRIQAEADGVLERHGRQVIELTDRAEM 82 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = +2 Query: 152 VHGKFSLIDLAGNERGAD 205 VHG++SL+D G++R D Sbjct: 118 VHGQYSLLDSDGHQRIVD 135 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = +2 Query: 152 VHGKFSLIDLAGNERGAD 205 VHG++SL+D G++R D Sbjct: 110 VHGQYSLLDSDGHQRIVD 127 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = +2 Query: 152 VHGKFSLIDLAGNERGAD 205 VHG++SL+D G++R D Sbjct: 110 VHGQYSLLDSDGHQRIVD 127 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = +2 Query: 152 VHGKFSLIDLAGNERGAD 205 VHG++SL+D G++R D Sbjct: 110 VHGQYSLLDSDGHQRIVD 127 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = +2 Query: 152 VHGKFSLIDLAGNERGAD 205 VHG++SL+D G++R D Sbjct: 110 VHGQYSLLDSDGHQRIVD 127 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = +2 Query: 152 VHGKFSLIDLAGNERGAD 205 VHG++SL+D G++R D Sbjct: 118 VHGQYSLLDSDGHQRIVD 135 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = +2 Query: 152 VHGKFSLIDLAGNERGAD 205 VHG++SL+D G++R D Sbjct: 142 VHGQYSLLDSDGHQRIVD 159 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = +2 Query: 152 VHGKFSLIDLAGNERGAD 205 VHG++SL+D G++R D Sbjct: 110 VHGQYSLLDSDGHQRIVD 127 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = +2 Query: 152 VHGKFSLIDLAGNERGAD 205 VHG++SL+D G++R D Sbjct: 118 VHGQYSLLDSDGHQRIVD 135 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = +2 Query: 152 VHGKFSLIDLAGNERGAD 205 VHG++SL+D G++R D Sbjct: 110 VHGQYSLLDSDGHQRIVD 127 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = +2 Query: 152 VHGKFSLIDLAGNERGAD 205 VHG++SL+D G++R D Sbjct: 118 VHGQYSLLDSDGHQRIVD 135 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = +2 Query: 152 VHGKFSLIDLAGNERGAD 205 VHG++SL+D G++R D Sbjct: 110 VHGQYSLLDSDGHQRIVD 127 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 23.4 bits (48), Expect = 7.0 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +2 Query: 152 VHGKFSLIDLAGNERGAD 205 VHG++SL+D G+ R D Sbjct: 118 VHGQYSLLDSDGHHRIVD 135 >AJ439060-4|CAD27755.1| 151|Anopheles gambiae putative sRNP protein. Length = 151 Score = 23.0 bits (47), Expect = 9.2 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +3 Query: 252 TVPPGTEGVHPRAGHEGQQPPALPRVQAHAGP 347 ++PP T + PR G P A P + GP Sbjct: 77 SIPPPTMNMPPRPGMIPGMPGAPPLLMGPNGP 108 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 23.0 bits (47), Expect = 9.2 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +1 Query: 190 RARRRHLLRQPTDQNGKRGDQQSLLALKECIRA 288 R + L PTD + D+Q+ ALK IRA Sbjct: 309 RIAEQRQLASPTDPDISALDRQARHALKTAIRA 341 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 591,304 Number of Sequences: 2352 Number of extensions: 11822 Number of successful extensions: 57 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 56 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 57 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 70668195 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -