BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021114 (695 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 23 2.8 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 22 4.8 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 22 4.8 DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 21 8.5 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 21 8.5 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 21 8.5 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 21 8.5 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 21 8.5 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 21 8.5 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 21 8.5 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 8.5 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 21 8.5 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 21 8.5 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 21 8.5 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 21 8.5 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 21 8.5 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 21 8.5 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 21 8.5 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 21 8.5 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 21 8.5 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 23.0 bits (47), Expect = 2.8 Identities = 15/41 (36%), Positives = 17/41 (41%) Frame = +1 Query: 70 RPDVGQLQLVALARRVPDRGAVPGHAPRAREVLAHRPGGQR 192 RPD L + L PD+ G RARE P G R Sbjct: 136 RPDTKDLPVPPLTEVFPDKYMDSGIFSRAREEANVVPEGAR 176 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 22.2 bits (45), Expect = 4.8 Identities = 13/50 (26%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = +1 Query: 247 DQQSLLALKECIRAL-GMKGNNHLPFRVSKLTQVLRDSFIGDKSRTCMIA 393 D+ + L L+E A ++ + +++ +L + L SF+G K + C+I+ Sbjct: 384 DETNQLTLQETADAFKDLQDKYYEEYKMYELGE-LASSFVGPKVKDCLIS 432 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 22.2 bits (45), Expect = 4.8 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = -2 Query: 181 QVDERELPVHAVHARGPHHDL 119 QVDERE P H G D+ Sbjct: 696 QVDEREYPESHGHDSGQDEDM 716 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 8.5 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +3 Query: 441 PIRRQGEGARHHGPV 485 P+R Q G+RH GP+ Sbjct: 111 PMRGQVPGSRHIGPL 125 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 8.5 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +3 Query: 441 PIRRQGEGARHHGPV 485 P+R Q G+RH GP+ Sbjct: 111 PMRGQVPGSRHIGPL 125 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 8.5 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +3 Query: 441 PIRRQGEGARHHGPV 485 P+R Q G+RH GP+ Sbjct: 111 PMRGQVPGSRHIGPL 125 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 8.5 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +3 Query: 441 PIRRQGEGARHHGPV 485 P+R Q G+RH GP+ Sbjct: 111 PMRGQVPGSRHIGPL 125 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 8.5 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +3 Query: 441 PIRRQGEGARHHGPV 485 P+R Q G+RH GP+ Sbjct: 111 PMRGQVPGSRHIGPL 125 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 8.5 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +3 Query: 441 PIRRQGEGARHHGPV 485 P+R Q G+RH GP+ Sbjct: 111 PMRGQVPGSRHIGPL 125 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 8.5 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +3 Query: 441 PIRRQGEGARHHGPV 485 P+R Q G+RH GP+ Sbjct: 111 PMRGQVPGSRHIGPL 125 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.4 bits (43), Expect = 8.5 Identities = 11/33 (33%), Positives = 14/33 (42%) Frame = -1 Query: 314 RWLLPFMPSARMHSFSARRDC*SPRFPFWSVGW 216 RW+L A AR +C + FP V W Sbjct: 680 RWILEPTDKAFAQGSDARVECKADGFPKPQVTW 712 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 8.5 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +3 Query: 441 PIRRQGEGARHHGPV 485 P+R Q G+RH GP+ Sbjct: 360 PMRGQVPGSRHIGPL 374 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 8.5 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +3 Query: 441 PIRRQGEGARHHGPV 485 P+R Q G+RH GP+ Sbjct: 360 PMRGQVPGSRHIGPL 374 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 8.5 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +3 Query: 441 PIRRQGEGARHHGPV 485 P+R Q G+RH GP+ Sbjct: 360 PMRGQVPGSRHIGPL 374 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 8.5 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +3 Query: 441 PIRRQGEGARHHGPV 485 P+R Q G+RH GP+ Sbjct: 360 PMRGQVPGSRHIGPL 374 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 8.5 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +3 Query: 441 PIRRQGEGARHHGPV 485 P+R Q G+RH GP+ Sbjct: 360 PMRGQVPGSRHIGPL 374 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 8.5 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +3 Query: 441 PIRRQGEGARHHGPV 485 P+R Q G+RH GP+ Sbjct: 360 PMRGQVPGSRHIGPL 374 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 21.4 bits (43), Expect = 8.5 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +3 Query: 441 PIRRQGEGARHHGPV 485 P+R Q G+RH GP+ Sbjct: 359 PMRGQVPGSRHIGPL 373 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 21.4 bits (43), Expect = 8.5 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +3 Query: 441 PIRRQGEGARHHGPV 485 P+R Q G+RH GP+ Sbjct: 344 PMRGQVPGSRHIGPL 358 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 21.4 bits (43), Expect = 8.5 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +3 Query: 441 PIRRQGEGARHHGPV 485 P+R Q G+RH GP+ Sbjct: 360 PMRGQVPGSRHIGPL 374 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 146,398 Number of Sequences: 438 Number of extensions: 2884 Number of successful extensions: 26 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21317625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -