BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021113 (685 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50893| Best HMM Match : SH3_1 (HMM E-Value=2e-33) 39 0.004 SB_5212| Best HMM Match : SH3_1 (HMM E-Value=4.9e-20) 38 0.010 SB_58222| Best HMM Match : HS1_rep (HMM E-Value=0) 36 0.023 SB_20181| Best HMM Match : RhoGEF (HMM E-Value=0.038) 36 0.031 SB_42788| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.040 SB_55426| Best HMM Match : SH3_1 (HMM E-Value=1.90002e-41) 35 0.071 SB_39120| Best HMM Match : SH3_1 (HMM E-Value=2e-20) 34 0.12 SB_43686| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_10210| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.66 SB_51657| Best HMM Match : SH3_1 (HMM E-Value=2.69999e-40) 31 0.87 SB_16207| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_50533| Best HMM Match : SH3_2 (HMM E-Value=2.3e-05) 31 1.1 SB_9279| Best HMM Match : Piwi (HMM E-Value=0) 31 1.1 SB_37165| Best HMM Match : SH3_1 (HMM E-Value=0) 31 1.1 SB_40386| Best HMM Match : BAR (HMM E-Value=0) 30 1.5 SB_54836| Best HMM Match : Chlam_PMP (HMM E-Value=7.9e-08) 30 2.0 SB_49681| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_18821| Best HMM Match : SH3_1 (HMM E-Value=5.7e-16) 29 2.7 SB_10886| Best HMM Match : SH3_1 (HMM E-Value=2.8e-19) 29 2.7 SB_43644| Best HMM Match : SH3_1 (HMM E-Value=0) 29 3.5 SB_8979| Best HMM Match : SH3_1 (HMM E-Value=3.6e-05) 29 3.5 SB_39694| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 29 4.6 SB_9732| Best HMM Match : SH3_1 (HMM E-Value=2e-17) 29 4.6 SB_58990| Best HMM Match : SH3_1 (HMM E-Value=1.7e-14) 29 4.6 SB_51507| Best HMM Match : SH2 (HMM E-Value=2.3e-22) 29 4.6 SB_34642| Best HMM Match : SH3_1 (HMM E-Value=1.7e-14) 29 4.6 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 29 4.6 SB_7592| Best HMM Match : PI-PLC-Y (HMM E-Value=1.1e-33) 29 4.6 SB_5826| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_56656| Best HMM Match : VWA (HMM E-Value=3.8e-26) 28 6.1 SB_20707| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_10902| Best HMM Match : SH3_1 (HMM E-Value=0) 28 8.1 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 28 8.1 SB_42698| Best HMM Match : SH3_1 (HMM E-Value=5.2e-16) 28 8.1 >SB_50893| Best HMM Match : SH3_1 (HMM E-Value=2e-33) Length = 665 Score = 38.7 bits (86), Expect = 0.004 Identities = 15/24 (62%), Positives = 17/24 (70%) Frame = +3 Query: 258 GWWRGELRGNRGIFPDNFVSLLNE 329 GW GEL G G+FPDNFV +L E Sbjct: 253 GWMEGELDGKTGLFPDNFVEILPE 276 Score = 37.9 bits (84), Expect = 0.008 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +3 Query: 246 KIAGGWWRGELRGNRGIFPDNFVSL 320 ++ GWW G + G +G+FP NFV L Sbjct: 35 EVEDGWWEGTVDGRKGVFPSNFVKL 59 Score = 32.7 bits (71), Expect = 0.28 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +2 Query: 587 QCRVLFTYAAVNDDELNLNEGDIVTVISK 673 + +V + Y N+DEL L GDI+T++ K Sbjct: 218 RAKVTYDYEQQNEDELELKVGDIITIVKK 246 >SB_5212| Best HMM Match : SH3_1 (HMM E-Value=4.9e-20) Length = 300 Score = 37.5 bits (83), Expect = 0.010 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +3 Query: 255 GGWWRGELRGNRGIFPDNFVSLLNE 329 G WW+GEL G G+FP N+V L + Sbjct: 266 GEWWKGELNGQVGMFPSNYVQSLGD 290 >SB_58222| Best HMM Match : HS1_rep (HMM E-Value=0) Length = 727 Score = 36.3 bits (80), Expect = 0.023 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = +3 Query: 246 KIAGGWWRGELRGNRGIFPDNFV 314 KI GWW G G RG+FP N+V Sbjct: 701 KIDDGWWMGTCNGQRGLFPANYV 723 Score = 29.5 bits (63), Expect = 2.7 Identities = 12/40 (30%), Positives = 26/40 (65%) Frame = +1 Query: 133 AMETNLSQKVSCTVNFAYDASEADELTIRPGDVISDVERL 252 A++ + +Q++ + + A E DE+T P D+I+D+E++ Sbjct: 664 ALDCHSTQRLLLILTLSLPAGE-DEITFDPDDIITDIEKI 702 >SB_20181| Best HMM Match : RhoGEF (HMM E-Value=0.038) Length = 274 Score = 35.9 bits (79), Expect = 0.031 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +3 Query: 249 IAGGWWRGELRGNRGIFPDNFV 314 + GGWW G L G G FP N+V Sbjct: 2 VDGGWWEGTLNGKNGWFPSNYV 23 >SB_42788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 617 Score = 35.5 bits (78), Expect = 0.040 Identities = 12/30 (40%), Positives = 21/30 (70%) Frame = +2 Query: 587 QCRVLFTYAAVNDDELNLNEGDIVTVISKV 676 QC+ ++ Y A DEL ++ GDI+TV +++ Sbjct: 564 QCKAIYDYQATQSDELTIHPGDIITVTARL 593 Score = 35.1 bits (77), Expect = 0.053 Identities = 14/29 (48%), Positives = 20/29 (68%) Frame = +1 Query: 166 CTVNFAYDASEADELTIRPGDVISDVERL 252 C + Y A+++DELTI PGD+I+ RL Sbjct: 565 CKAIYDYQATQSDELTIHPGDIITVTARL 593 Score = 33.5 bits (73), Expect = 0.16 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = +3 Query: 246 KIAGGWWRGELRGNRGIFPDNFV 314 ++ GWW+G+L +GIFP ++V Sbjct: 592 RLDNGWWQGDLNNQQGIFPASYV 614 >SB_55426| Best HMM Match : SH3_1 (HMM E-Value=1.90002e-41) Length = 689 Score = 34.7 bits (76), Expect = 0.071 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = +3 Query: 246 KIAGGWWRGELRGNRGIFPDNFV 314 K G WW G LR N G+FP N+V Sbjct: 208 KDEGEWWEGRLRENYGLFPANYV 230 Score = 32.7 bits (71), Expect = 0.28 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +3 Query: 261 WWRGELRGNRGIFPDNFVSLLNEYATT 341 WW GEL G +G FP +V L + T Sbjct: 169 WWSGELNGKKGWFPKTYVKLTSTAVKT 195 Score = 31.5 bits (68), Expect = 0.66 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = +2 Query: 584 EQCRVLFTYAAVNDDELNLNEGDIVTV 664 E RVL+ + N DE+ +NE DIVTV Sbjct: 14 EYYRVLYAFEPRNPDEIEVNEDDIVTV 40 Score = 30.3 bits (65), Expect = 1.5 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +3 Query: 258 GWWRGELRGNRGIFPDNFVSLLNE 329 GW RG+ G G+FP N+ ++E Sbjct: 50 GWLRGKCHGKTGLFPANYAEKISE 73 >SB_39120| Best HMM Match : SH3_1 (HMM E-Value=2e-20) Length = 524 Score = 33.9 bits (74), Expect = 0.12 Identities = 15/27 (55%), Positives = 19/27 (70%) Frame = +1 Query: 157 KVSCTVNFAYDASEADELTIRPGDVIS 237 K V + Y+A+ ADELTI PGDVI+ Sbjct: 309 KKQVLVMYPYEANRADELTITPGDVIT 335 Score = 30.7 bits (66), Expect = 1.1 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +2 Query: 581 KEQCRVLFTYAAVNDDELNLNEGDIVTVI 667 K+Q V++ Y A DEL + GD++TV+ Sbjct: 309 KKQVLVMYPYEANRADELTITPGDVITVL 337 >SB_43686| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 379 Score = 32.7 bits (71), Expect = 0.28 Identities = 19/50 (38%), Positives = 28/50 (56%) Frame = -3 Query: 299 ENAAVST*LASPPAPGNLSTSLITSPGLIVSSSASDASYAKLTVQDTFCD 150 +N +V + LASP G S S + SPGL + S S+ S++ DTF + Sbjct: 4 DNGSVGSPLASPGFNGTTSESPLASPGLNGTGSDSETSWS-FDTSDTFSE 52 >SB_10210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 793 Score = 31.5 bits (68), Expect = 0.66 Identities = 12/24 (50%), Positives = 18/24 (75%) Frame = +2 Query: 593 RVLFTYAAVNDDELNLNEGDIVTV 664 R L+ Y A++D+EL+ NEGD + V Sbjct: 565 RALYDYEAMSDEELSFNEGDTIYV 588 >SB_51657| Best HMM Match : SH3_1 (HMM E-Value=2.69999e-40) Length = 313 Score = 31.1 bits (67), Expect = 0.87 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 261 WWRGELRGNRGIFPDNFVSL 320 W +G L GN GIFP ++V L Sbjct: 221 WLKGSLNGNTGIFPSSYVEL 240 >SB_16207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 31.1 bits (67), Expect = 0.87 Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 2/45 (4%) Frame = -2 Query: 258 PRQSFNVAYHVPRSDR--QLVRF*CIIREVNGARHFL**ICLHCR 130 PR+ N Y V RS++ QLV++ C+ VNG + +C +CR Sbjct: 87 PRKCTNDTYSVTRSEKESQLVKWFCMGYYVNGLKAVAKRVCSYCR 131 >SB_50533| Best HMM Match : SH3_2 (HMM E-Value=2.3e-05) Length = 156 Score = 30.7 bits (66), Expect = 1.1 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +2 Query: 578 VKEQCRVLFTYAAVNDDELNLNEGDIVT 661 V + RV+ + + DDEL+LN GDI+T Sbjct: 4 VPVEARVITDHKTLMDDELDLNAGDIIT 31 Score = 29.5 bits (63), Expect = 2.7 Identities = 14/39 (35%), Positives = 21/39 (53%), Gaps = 2/39 (5%) Frame = +3 Query: 261 WWRGELRGNRGIFPDNFVSLLNEYATTRSTGV--QGRCR 371 +W G L+G RG FP + V ++ + T V QGR + Sbjct: 42 YWMGTLKGKRGFFPKDCVEVIKQGKTKGCVEVIKQGRTK 80 >SB_9279| Best HMM Match : Piwi (HMM E-Value=0) Length = 941 Score = 30.7 bits (66), Expect = 1.1 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = +2 Query: 578 VKEQCRVLFTYAAVNDDELNLNEGDIVTVISK 673 V E+ R + Y A + E+ L EG++VTVI K Sbjct: 811 VVERYRAVARYMASSSGEMTLGEGEVVTVIEK 842 >SB_37165| Best HMM Match : SH3_1 (HMM E-Value=0) Length = 1034 Score = 30.7 bits (66), Expect = 1.1 Identities = 11/30 (36%), Positives = 22/30 (73%) Frame = +2 Query: 587 QCRVLFTYAAVNDDELNLNEGDIVTVISKV 676 + R L+ ++A++ +L L+EGD++TV+ V Sbjct: 358 KARALYHFSALHSGDLELSEGDVITVLKIV 387 Score = 27.9 bits (59), Expect = 8.1 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +3 Query: 246 KIAGGWWRGELRGNRGIFPDNFV 314 +I W RG++ G GIFP FV Sbjct: 155 EIGNNWLRGDINGTIGIFPCVFV 177 >SB_40386| Best HMM Match : BAR (HMM E-Value=0) Length = 369 Score = 30.3 bits (65), Expect = 1.5 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +2 Query: 578 VKEQCRVLFTYAAVNDDELNLNEGDIVTVISK 673 +K C+ F Y A + EL+ EG I+T+ K Sbjct: 303 LKPSCKAKFDYKAKKEGELSFTEGQIITLSGK 334 Score = 27.9 bits (59), Expect = 8.1 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +3 Query: 261 WWRGELRGNRGIFPDNFVSLLNEYATTRST 350 W+ G L G GIFP V +L + +T Sbjct: 339 WYEGTLDGKFGIFPSALVQILTDLPAEEAT 368 >SB_54836| Best HMM Match : Chlam_PMP (HMM E-Value=7.9e-08) Length = 598 Score = 29.9 bits (64), Expect = 2.0 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +1 Query: 265 GEASYVETAAFSRTTSFLF*TNMLLRDQRACKGGVGLCTA 384 G ++ T +SR F+F TN L A + G GLC A Sbjct: 287 GAGVFIATGGYSRDNEFIF-TNAALHRNWASQAGGGLCIA 325 >SB_49681| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 29.9 bits (64), Expect = 2.0 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = -1 Query: 361 PCTPVDLVVAYSFRRETKLSGKMPRFPRNSPRHQPPAI 248 PC P L A +F R+ L+GK P R+Q PA+ Sbjct: 44 PCPPKALPEAATFTRKDPLAGKQPSICGIPTRYQLPAL 81 >SB_18821| Best HMM Match : SH3_1 (HMM E-Value=5.7e-16) Length = 299 Score = 29.5 bits (63), Expect = 2.7 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +2 Query: 599 LFTYAAVNDDELNLNEGDIVTVISK 673 L+ Y A DDEL+ G+IVT +S+ Sbjct: 249 LYDYEAAEDDELSFKAGEIVTKLSE 273 >SB_10886| Best HMM Match : SH3_1 (HMM E-Value=2.8e-19) Length = 152 Score = 29.5 bits (63), Expect = 2.7 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +3 Query: 246 KIAGGWWRGELRGNRGIFPDNFVSL 320 +I W GE+ G GIFP N+V L Sbjct: 16 QIDRNWIEGEVNGRIGIFPTNYVEL 40 >SB_43644| Best HMM Match : SH3_1 (HMM E-Value=0) Length = 704 Score = 29.1 bits (62), Expect = 3.5 Identities = 10/35 (28%), Positives = 18/35 (51%) Frame = +3 Query: 246 KIAGGWWRGELRGNRGIFPDNFVSLLNEYATTRST 350 K GWW G++ GN G P +++ + ++T Sbjct: 230 KNPNGWWYGKIDGNEGWIPSSYLGKREKSVKKKAT 264 >SB_8979| Best HMM Match : SH3_1 (HMM E-Value=3.6e-05) Length = 169 Score = 29.1 bits (62), Expect = 3.5 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = +2 Query: 584 EQCRVLFTYAAVNDDELNLNEGDIVTVISK 673 E+ + ++ Y+ N+DEL L EG+ V V+ K Sbjct: 57 ERFKAMYGYSPQNEDELPLEEGEEVFVLEK 86 >SB_39694| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 893 Score = 28.7 bits (61), Expect = 4.6 Identities = 16/72 (22%), Positives = 33/72 (45%) Frame = +1 Query: 136 METNLSQKVSCTVNFAYDASEADELTIRPGDVISDVERLPGAGGEASYVETAAFSRTTSF 315 ++ LS+ C + Y+A+E DEL+ + + I + + P G+ + + Sbjct: 12 LQAILSRSDLCIALYDYEAAEEDELSFKANECIELLSKDPEISGDEDWWVGRVDGQEKIG 71 Query: 316 LF*TNMLLRDQR 351 LF N + ++R Sbjct: 72 LFPANYVTNEKR 83 >SB_9732| Best HMM Match : SH3_1 (HMM E-Value=2e-17) Length = 1860 Score = 28.7 bits (61), Expect = 4.6 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +2 Query: 587 QCRVLFTYAAVNDDELNLNEGDIVTVISKV 676 Q + + Y DEL L+EGD++ V+ K+ Sbjct: 935 QVQAIHNYTPQQPDELALHEGDVINVLRKL 964 >SB_58990| Best HMM Match : SH3_1 (HMM E-Value=1.7e-14) Length = 167 Score = 28.7 bits (61), Expect = 4.6 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = +3 Query: 261 WWRGELRGNRGIFPDNFVSLLNEYATTRSTGVQGRCR 371 W++ E+ GN G+ P N++ L G +G R Sbjct: 36 WYQAEMDGNSGMIPANYIELKPHERAACMCGTRGGLR 72 >SB_51507| Best HMM Match : SH2 (HMM E-Value=2.3e-22) Length = 192 Score = 28.7 bits (61), Expect = 4.6 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +2 Query: 581 KEQCRVLFTYAAVNDDELNLNEGDIVTVISK 673 K CR L+ Y +ND E+ G +T + K Sbjct: 128 KPACRALWDYEGINDQEMTFCRGAFITNVVK 158 >SB_34642| Best HMM Match : SH3_1 (HMM E-Value=1.7e-14) Length = 237 Score = 28.7 bits (61), Expect = 4.6 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +2 Query: 587 QCRVLFTYAAVNDDELNLNEGDIV 658 Q V++ Y A +DDE+++ EGDI+ Sbjct: 181 QYLVMYDYNAADDDEVSMVEGDII 204 >SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) Length = 634 Score = 28.7 bits (61), Expect = 4.6 Identities = 18/63 (28%), Positives = 29/63 (46%) Frame = -1 Query: 376 RARHRPCTPVDLVVAYSFRRETKLSGKMPRFPRNSPRHQPPAIFQRRLSRPPV*SSARPL 197 R + P+DL AY R +LSG+ P + +P + I +R +PP+ + P Sbjct: 143 RGKRTKNPPIDLGPAYFHIRGKRLSGEQPPYLDLTPAYF--HIRGKRTQQPPMIDLSEPA 200 Query: 196 LMH 188 H Sbjct: 201 FFH 203 >SB_7592| Best HMM Match : PI-PLC-Y (HMM E-Value=1.1e-33) Length = 997 Score = 28.7 bits (61), Expect = 4.6 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +2 Query: 581 KEQCRVLFTYAAVNDDELNLNEGDIVTVISK 673 K CR L+ Y +ND E+ G +T + K Sbjct: 223 KPACRALWDYEGINDQEMTFCRGAFITNVVK 253 >SB_5826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 402 Score = 28.7 bits (61), Expect = 4.6 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +3 Query: 246 KIAGGWWRGELRGNRGIFPDNFVSL 320 K+ W G+L GIFP NFV L Sbjct: 267 KVDENWCEGKLNNKCGIFPINFVEL 291 >SB_56656| Best HMM Match : VWA (HMM E-Value=3.8e-26) Length = 2157 Score = 28.3 bits (60), Expect = 6.1 Identities = 10/28 (35%), Positives = 20/28 (71%) Frame = +2 Query: 599 LFTYAAVNDDELNLNEGDIVTVISKVSP 682 L+ + A +D++ ++GD+VTV++K P Sbjct: 1896 LWDFNATAEDDITASKGDVVTVLNKDDP 1923 >SB_20707| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 705 Score = 27.9 bits (59), Expect = 8.1 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +2 Query: 581 KEQCRVLFTYAAVNDDELNLNEGDIVT 661 +E+ + Y A + DE+ L EGDI+T Sbjct: 356 EERYVAAYNYTASDTDEIGLQEGDIIT 382 >SB_10902| Best HMM Match : SH3_1 (HMM E-Value=0) Length = 824 Score = 27.9 bits (59), Expect = 8.1 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = +2 Query: 602 FTYAAVNDDELNLNEGDIVTVISK 673 F+Y ++ DEL L +GD++ V+ K Sbjct: 211 FSYQPIHVDELQLTKGDLIHVLEK 234 >SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) Length = 558 Score = 27.9 bits (59), Expect = 8.1 Identities = 14/27 (51%), Positives = 17/27 (62%) Frame = -3 Query: 266 PPAPGNLSTSLITSPGLIVSSSASDAS 186 PP P N+S S++TS GL V SD S Sbjct: 110 PPTPSNMS-SIVTSIGLGVKDGLSDLS 135 >SB_42698| Best HMM Match : SH3_1 (HMM E-Value=5.2e-16) Length = 505 Score = 27.9 bits (59), Expect = 8.1 Identities = 10/31 (32%), Positives = 19/31 (61%) Frame = +2 Query: 581 KEQCRVLFTYAAVNDDELNLNEGDIVTVISK 673 + + + L + +DDEL + DI+T+IS+ Sbjct: 119 RRRAKALLDFERHDDDELGFRKNDIITIISQ 149 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,375,337 Number of Sequences: 59808 Number of extensions: 406558 Number of successful extensions: 1048 Number of sequences better than 10.0: 34 Number of HSP's better than 10.0 without gapping: 927 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1047 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1769412099 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -